CAZyme Information: MGYG000002478_00862

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00862
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000002478_1|CGC24	92696.22	6.1917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 1195169; End: 1197595 Strand: -

Full Sequence      

MKKIFLFLYTLLVFSGVYAQENKVKVEPVNGDKISLFSLKEVRLLDSDFKHIMDLNHAYM
LSLEPDRLLSWFRREAGLTPKAQPYPFWESEYMNGHGPLPGHIMGFYLSGISMMYDSTGD
TAILSRLSYILEELSLCQQAGGDGYLLPTICGRAIFENVLDGNFKTSNPFIETPYDKCWE
PVYVMNKIMLGLYQVYMRCDLLQAKEILVKMADWFGYSVIDKLSHDDLQKLLVCEHGSIN
ESFIDVYQITGEEKYLKWAQRLNDEDMWVPMSEGKDILEGWHANTQIPKFTGFESVYRYD
SNERFTTAARFFWDTVVRKHTWVMGGNSTGEHFFAPEEFEHRIELNGGPESCNSVNMLRL
TESLYCDYAEVEKVDYYEKVLFNHILANYDPDQGMCVYYTSMKPGHYKIYGTKYDSFWCC
TGTGFEQTAKFGQMIYAHTDDALYVNMFIPSVVTWDKGISIHQETAFPDEGVTSLTVSGE
AVFNLKIRCPYWVGSSSLNVIVNGKREKIKAGVDGYVSINRQWKDGDKVRIELPMKLEIV
PLNEATHYLALKYGPIVLAARISDEHLSKDDFRSARSTVAMKDYPVIDVPAFIGDIRKIP
AAVIRKKGEKLAFLCSKDNVVSKPVELVPFNTIHWSRYAVYFRHYDKKENYLAELKKSEQ
FKQEEDNLNKRTVDRVIIADAESEKMHKMEAVNSTAGENWRDASKGGYFMYEMKVRKEME
QSVCLQLLGSDSGNRIFDVLIDGKWIDTIDLSKPCKEGKGLYRCYIHIPAEYIKARKNVT
VKFQAKNGCIAGGIFDVRIVSAISVQDM

Enzyme Prediction     

No EC number prediction in MGYG000002478_00862.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	559	6.8e-182	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.77e-176	41	559	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.87e-94	39	572	9	509	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.85e-10	580	642	20	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86295.1	0.0	1	808	1	808
QJR53578.1	0.0	1	808	1	808
ALA72773.1	0.0	1	808	1	808
QJR78609.1	0.0	1	808	1	808
QJR61625.1	0.0	1	808	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.41e-153	33	766	24	770	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	4.14e-147	33	721	24	728	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	3.16e-24	206	618	166	600	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	9.16e-23	236	557	191	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.49e-22	236	557	191	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.999006	0.000207	0.000147	0.000154	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_00862.