CAZyme Information: MGYG000002478_00834

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00834
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	MGYG000002478_1|CGC23	87248.53	6.7749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 1140826; End: 1143090 Strand: +

Full Sequence      

MQMYMKNIFLLLSWLILLPSGILANPIKGMLERIDKGASNKFVVELHKSPNDFFELDRKG
DKVVIRGNTYINIATGINWYLKYHAGIHLSWNGMHASLPDVLPPVLRKERHETNLALRYD
FNYCTYSYSMAFWDWKRWEKELDWMALHGINLPLAAVGHECVWRNLLLRLGFSKQQINNF
IAGPAFLAWWEMNNLEGWGGPNPDSWYEQQEALQKKILQRMKEWGMHPVLPGYSGMIPSK
LDLGKRIDSGKEEKTAGDTSSESAQSTLNKWNGFDRPGILLPDDPKFTRIANLFYEETEK
LYGTSDYYSIDPFHEAKNLPAELDFGKAGRAIMDAMKKANPKAVWVVQGWTENPRPEMMK
ALNPGDLLILDLFSECRPMWGIPSIWKRDKGYEEHNWLFCLLENFGGNVGLHGRMDQLLH
NFYLTKNNPLAAQLKGIGLTMEGIENNPVMFELMCELPWRAEKFTKEEWIKQYIRARYGT
DDESIRQAWQILANGIYNCPAGNNQQGPHESIFCGRPSLNNFQASSWSKMCNYYDPTTTT
EAARLMVSVADKYRGNNNFEYDLVDITRQAIADRARIVYNYAVADFKSFDKKNYNTHTRQ
FLELLMMQDKLLGTRKEFKVGNWIQQARNLGITPEEKDLYEWNARVQITTWGNRYCADIG
KLRDYAHKEWNGLLRDFYYKRWEKYWQVLQDQLDGKLPVLPVGNSSTPTADNPAMTIDWY
ALEEPWTLAKNTYAASAEGDCIEVAKEAITLINN

Enzyme Prediction     

No EC number prediction in MGYG000002478_00834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	60	749	5.1e-247	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	7.41e-170	118	461	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	5.04e-108	469	746	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	4.14e-31	25	103	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR53605.1	0.0	1	754	1	754
ALA72748.1	0.0	1	754	1	754
QJR61598.1	0.0	1	754	1	754
AII66920.1	0.0	1	754	1	754
QJR78581.1	0.0	1	754	1	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.43e-149	25	753	172	881	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.76e-149	25	753	180	889	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.02e-148	25	753	195	904	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.26e-124	62	747	51	706	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	5.97e-129	37	750	75	802	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	1.28e-123	62	747	74	729	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999200	0.000165	0.000144	0.000139	0.000131

TMHMM  Annotations     

start	end
7	24