CAZyme Information: MGYG000002478_00177

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00177
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502	MGYG000002478_1|CGC8	57133.36	6.9815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 269820; End: 271328 Strand: -

Full Sequence      

MKMICMAVMLFITLLSAGAQKNIPASDIKVAMMKATRFMVEKVSNRGGYLWNYSPDFSRC
WGELEAKPSMIWIEAGTPAMGNVFLNAYQLTGESYYLKAAQAVADALIWGQHSSGGWPYM
LDFSGETSLKQWYSKVQKGYIHCAQEHAHYYGNCTYDDAATYDSGMFLLRMYLLTLDPKY
KYPVERCLDFVLESQYPIGGWPQRYPLHYEYVKGDKEDYTSFITINDGVHTNNINFLLAC
YTLLGETRALEPLQRAMTCVLALQGGKPQAGWAMQHKLDLNYSPGHARDFEPAGYAATAT
AEMCRNLMRFYRWTGDTKYLARIPDAFEFLESIRYNDAQMKQLGKSVKPGQILCPTFVEV
GTNRPLYLHNDPDHYWVDYDYHGLITHYSSTRAIDLQSLKDEYQHLLSLSKEEVTKDSPF
IGQTDISGTLLSHLMRGKMQQADTQKVDSLLTILKKKDYLPGRLPSVSKENPGFSNAPLP
SEVISIKEYMNGMSTFIQYLTK

Enzyme Prediction     

No EC number prediction in MGYG000002478_00177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	111	390	1.4e-122	0.9963636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02474	pec_lyase	4.00e-22	111	367	1	257	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam09492	Pec_lyase	4.05e-20	111	367	1	256	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
PTZ00470	PTZ00470	0.002	80	225	161	283	glycoside hydrolase family 47 protein; Provisional
pfam05147	LANC_like	0.004	75	330	104	301	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR61060.1	0.0	1	502	1	502
QJR54142.1	0.0	1	502	1	502
ALA72200.1	0.0	1	502	1	502
AII66360.1	0.0	1	502	1	502
QUT85482.1	0.0	1	502	1	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	3.81e-12	95	308	78	303	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	4.44e-07	98	371	31	294	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	4.33e-06	98	371	31	294	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000304	0.999095	0.000174	0.000144	0.000132	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_00177.