CAZyme Information: MGYG000002476_03884

Basic Information

• Species: Yersinia pestis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia pestis
• CAZyme ID: MGYG000002476_03884
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212	MGYG000002476_3|CGC38	23616.3	10.3132

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002476	4935125	Isolate	Russia	Europe

• Gene Location: Start: 4198186; End: 4198824 Strand: -

Full Sequence      

MANRSILTAIFLMLFILGNGLPASAKTHPTLQTIPSIYREIAAEARVPAAFLYSLALVES
SRRFKGGERPWPWTINVAGKGYRYETREEAWHALLRFVRQAPLKRIDVGIAQVNLGWNGH
LFPSFYDVFDPNTNLRVAAQILRACYENRAGSWINAAGCYHHPAGGKPAANYIAIVRRKL
DTLAPVHIAVSSKTTISDVTSVNHPLIWIEPK

Enzyme Prediction     

No EC number prediction in MGYG000002476_03884.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	1.88e-11	58	160	20	121	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13400	LT_IagB-like	2.60e-10	47	180	3	107	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	0.002	31	157	104	233	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS46853.1	1.64e-155	1	212	1	212
AHK18385.1	1.64e-155	1	212	1	212
CAX67712.1	8.09e-147	1	212	1	212
AJJ25394.1	3.16e-144	1	212	1	212
AYW94157.1	2.95e-133	31	212	1	182

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999193	0.000158	0.000150	0.000135	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002476_03884.