CAZyme Information: MGYG000002476_00227

Basic Information

• Species: Yersinia pestis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia pestis
• CAZyme ID: MGYG000002476_00227
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
183	MGYG000002476_2|CGC1	20594.44	9.2502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002476	4935125	Isolate	Russia	Europe

• Gene Location: Start: 140976; End: 141527 Strand: +

Full Sequence      

MGDGLSDMKIMVIITFSLITISHNLKAEIPAINNTNFYSYRPASIECVIEAARRQGVPAN
ILLSLASLESGKNGQRVTNTNGSTDIGHFQINTINWNDGKFAGLLEISENDVALRGCYNA
ELAAWILKSRINESNGQDFWTKVANYHSKTKKYNDIYKAKLMPLAVRWGNWLEKRGEYTV
TYR

Enzyme Prediction     

No EC number prediction in MGYG000002476_00227.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13888	PRK13888	6.21e-47	45	181	15	148	conjugal transfer protein TrbN; Provisional
cd13400	LT_IagB-like	6.56e-28	56	162	2	104	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK12712	flgJ	1.46e-04	51	96	211	257	flagellar rod assembly protein/muramidase FlgJ; Provisional
cd16899	LYZ_C_invert	3.10e-04	53	96	13	61	C-type invertebrate lysozyme. C-type lysozyme proteins of invertebrates, including digestive lysozymes 1 and 2 from Musca domestica, which aid in the use of bacteria as a food source. These lysozymes have high expression in the gut and optimal lytic activity at a lower pH. Other lysozymes in this subfamily have immunological roles. e.g. Anopheles gambiae has eight lysozymes, most of which seem to have immunological roles, those some may function as digestive enzymes in larvae. C-type lysozyme (chicken or conventional type; 1, 4-beta-N-acetylmuramidase) has bacteriolytic properties through the hydolysis of beta-1,4, glyocosidic linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins.
pfam00062	Lys	5.48e-04	65	101	31	68	C-type lysozyme/alpha-lactalbumin family. Alpha-lactalbumin is the regulatory subunit of lactose synthase, changing the substrate specificity of galactosyltransferase from N-acetylglucosamine to glucose. C-type lysozymes are secreted bacteriolytic enzymes that cleave the peptidoglycan of bacterial cell walls. Structure is a multi-domain, mixed alpha and beta fold, containing four conserved disulfide bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS45748.1	9.41e-115	25	183	1	159
QTP13337.1	2.95e-74	36	183	27	178
QHB30063.1	1.97e-64	36	175	24	164
BBU46966.1	1.97e-64	36	175	24	164
AOX11182.1	5.62e-64	36	175	24	164

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000214	0.999185	0.000162	0.000140	0.000136	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002476_00227.