CAZyme Information: MGYG000002474_03230

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_03230
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594	MGYG000002474_21|CGC2	64984.73	4.7855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 21385; End: 23169 Strand: +

Full Sequence      

MRRTKDKALLQLLTLSCLMSGMAPALAADTSEPYVIKESDLIKKENSLTQNPLMQEVKAS
IRTLDNDSVDKIAPGRSDNPANVKRVESILGSDKWDYIFPLRDPSYTYTKFLQAIGKFPA
VCGTYTDGRDSDAICRKGLATMFAHFAQETGGHENWRPEAEWRQGLVYLREMGWKEGQKG
GYNGECNPNVWQGQTWPCGKDADGDFVSYFGRGAKQLSYNYNYGPFSDAMFGTVRTLLDK
PELVADTWLNLASAVFFYVTPQAPKPSMLHVIDGTWQPNDRDKANGLVPGFGVTIQIING
GVECGGAQEIAQGLNRISYYKSEAEYLKVPVPANEVLGCKNMKQFDEGGAGALPQYWEQD
WGWSAETPTGLTYSCQLVGYQTPFSAFKEGDYKRCVQHYFNVKVVDDAGKEEAVTPAPEP
TPAPTPEPTPAPADGNSAPVAKLSGPIGDVESQANVTLNAAESTDADGDKLTYSWLLPNG
TTLAGNDRKSLSFVAPVVTSKQSFNFTLTVSDSKKSSVATYVLTVTPKVLPLPDAGTSSG
CADNWDAGKVYNGGESVNWKGKEYLANYWTQDNEPGNPSFTGEWSQWKEIKACK

Enzyme Prediction     

No EC number prediction in MGYG000002474_03230.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	82	339	8.8e-73	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	2.21e-70	92	339	3	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.86e-39	106	334	25	229	Chitinase class I.
COG3979	COG3979	1.19e-29	69	224	40	181	Chitodextrinase [Carbohydrate transport and metabolism].
cd12215	ChiC_BD	1.76e-10	543	589	1	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00736	CADG	5.65e-06	449	527	10	93	Dystroglycan-type cadherin-like domains. Cadherin-homologous domains present in metazoan dystroglycans and alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from magnetotactic bacteria. Likely to bind calcium ions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZP47966.1	0.0	1	594	1	594
ADW75215.1	0.0	1	594	1	594
AZP43629.1	0.0	1	594	1	594
AZP52416.1	0.0	1	594	1	594
AFE59861.1	0.0	1	594	1	594

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V92_A	7.19e-35	106	348	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V91_A	2.38e-33	106	348	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
4DWX_A	1.55e-32	106	345	30	243	CrystalStructure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DWX_B Crystal Structure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DYG_A Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale],4DYG_B Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale]
4J0L_A	2.13e-32	106	345	30	243	CrystalStructure of a Family GH19 Chitinase (W72A/E67Q mutant) from rye seeds in complex with two (GlcNAc)4 molecules [Secale cereale]
2BAA_A	7.35e-32	106	345	29	242	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	2.01e-36	106	348	94	310	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P52403	2.90e-36	106	348	96	312	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P52405	1.42e-35	106	348	96	312	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
Q05538	2.94e-35	106	348	100	316	Basic 30 kDa endochitinase OS=Solanum lycopersicum OX=4081 GN=CHI9 PE=1 SV=1
P24091	3.07e-35	88	348	77	318	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000437	0.994742	0.004108	0.000303	0.000208	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_03230.