CAZyme Information: MGYG000002472_01553

Basic Information

• Species: Lentilactobacillus kefiri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus kefiri
• CAZyme ID: MGYG000002472_01553
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	MGYG000002472_1|CGC15	83987.13	4.7744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002472	2568073	Isolate	Italy	Europe

• Gene Location: Start: 1563399; End: 1565579 Strand: +

Full Sequence      

MKPVSYYDIQYLPGSTLKEKFDRNINWMLSLTTDQLLYNYRKNAGMDTKGATPLTIWESP
DWFFRGHFTGHYLSGASKSFVELNNMDDTETARELKKRVDKIVDGLKECQQKFDTFEEFP
GYLAAEPSKRFDDIEKLRFNGNHYVPYYAVQKLMDGLMDAYEFTGNKIALDLTENMTHYF
EKRMARLTPERINAMIDTRWYQGNGQYVFHQEFGAMHRTLLRLYEMTGKKEQDVFDLAEK
FDRKWFRDMLINNDDELGYYSCHSNTELVCAEGMLEYYHTTGDEKYKKGVVNYMNWMHTG
HELPTKGISGRSAYPAPADYGSELYDYPEMFFKHLSKLNGESCCSHDLNYLSSELFADTK
DVTLMDDYEIRFINAIMAQQNNDSAIAEYLYNLSVSPNATKEFDRGGFWCCVGSGTERHS
TLVDGIYYEDGNDIYVAQYFDSILNLKDKGITITQDSHYPDQHFAHITVESDKDQEFTVY
VRVPKWSAETTITVDGKKVSAQPKNGFVAIKRSWGKKSEIKVNLDFQLHYQTLADRFNRV
AIYYGPILLAAQTKDLPTSTKPAAEYLADLVKVEDKNQFRLSGTDIIFKSLPEIPADTPY
NVYVKVPEEEVATTIDTQNDSDNPVNEDHSWTLAVDPEKKNYLKITYDYLDGDVYSFQIQ
DDDKVLFTQTIKNEEWPEDSYYIYPLPADATKGKNKINIKITPLDYEGLNFDIANINKIE
TMVANK

Enzyme Prediction     

No EC number prediction in MGYG000002472_01553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	14	550	6.4e-126	0.9880715705765407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.31e-95	18	550	10	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.98e-59	1	555	3	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGV24839.1	0.0	1	726	1	726
QPI45544.1	0.0	1	724	1	722
ASB48773.1	2.05e-88	12	606	46	615
QSW89191.1	7.10e-84	15	555	4	521
QSB26316.1	7.04e-79	12	606	40	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.63e-44	4	553	25	563	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	9.86e-42	4	553	25	563	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.37e-15	88	572	91	591	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.46e-15	88	572	91	591	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.14e-10	147	555	142	550	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002472_01553.