CAZyme Information: MGYG000002470_04444

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04444
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000002470_8|CGC5	45814.55	5.4757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 303565; End: 304767 Strand: -

Full Sequence      

MMNSKQVFFGLLACIAALIGCDTRKQVVVGNELSLTRAKQTLDSLYQNYSAPGTCLLREN
YPSNVGDYTATYLASEEQKNIPNQYSYLWPYSGTFSAVSALYEVTQDTLYKSLLDKKVLI
GLEEYFDTQRTPEAYASYIRTAPQSDRFYDDNVWLGIDFTDTYLATKEDKYLQKAKLIWK
FIESGMDDNLGGGIYWCEQKKGSKNTCSNAPGSVLALKLFKATQDSAYLKQGEQLYKWTQ
AQLQDSTDYLYFDNISLNGKIGKAKFAYNSGQMMQSASLLYQLTGKEEYLTDAQNIAQAC
HNYFFTDYTPEHGEAFRMIKQGDVWFTAVMLRGFIELYHIDHNKTYLDSFNKSLDHAWEH
ARDEKGLFNTDFTGNNRNERKWLLTQAAMVEMYARLAAIQ

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	71	383	3.9e-72	0.8379888268156425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.35e-31	60	307	21	258	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.29e-11	145	299	88	243	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71507.1	7.18e-301	2	400	1	399
QGT72765.1	9.42e-249	2	400	1	399
ALJ59939.1	8.60e-245	2	400	1	399
QUT89047.1	1.17e-242	2	400	1	399
BAD50241.1	4.64e-219	2	397	1	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.26e-101	38	396	8	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	6.95e-71	88	400	45	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	1.00e-69	54	397	137	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4V1S_A	1.71e-27	3	393	6	372	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	1.70e-24	3	393	6	372	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O14131	1.67e-06	97	296	49	264	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1
Q5ACZ2	2.25e-06	86	307	63	293	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.003745	0.996300	0.000001	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04444.