CAZyme Information: MGYG000002470_04012

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04012
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
778	MGYG000002470_7|CGC6	89361.1	6.6872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 226848; End: 229184 Strand: +

Full Sequence      

MKKVFLSLFLFLITQLCWAQFNLPSGKPVKVSCDNAEEKVVHTALDLLSRDCKAVLSASL
LVDNEQGDIIIGTVGKSPLIAKTGADVSGLNGKKQAFLLTVLPDGKLLVAGSDQHGTAYG
IMELSRLLGVSPWEWWADVIPGKKEFFQLAADYKTVQSPSVEYRGIFINDEDWGLMPWSS
LNYEPWYKPGRIGPQTNERIFELLLRLRANTYWPAMHECSVPFFLTPGNREAAEKFGIYI
GGSHCEPMACSTAGEWSRRGKGDYDYVKNSSSVCHFWEERLKEVSGQEILYTVGMRGVHD
GQMQGAKTVEEQKAVLERVLKDQRDLLRKYVNKDVEAVPQVFIPYKEVLDVYRAGLEVPE
DVTLMWCDDNYGYIKHFPTEAERARKGGNGVYYHVSYWGRPHDYLWLGTFSPALLYQQMK
EAYERGIQKIWILNVGDIKPIEYQTELFLDMAWNIDQFTEGGVSDHLCNFLKREFGETTG
EDLLPVMMEHYRLSYIRKPEFMGNTREEEYHTNAYRIVKDMPWSRSYINKRLEDYQVISD
KVEKLASRIQRDRRDAYFQLVKYPVQATAEMNKKMLYAQFARHGEMNWNKSDAAYDSIAS
LTRIYNIGIRNNGKWHRMMDHQPRRLPVFEPVDRLLVETPMLEDSPSLYKWNGVEYSAGD
AVSCKGLGYEGKAVMLEKNKELSFDFGECPGDSVEVEIRLLPNHPIHGGQLRFSVSIDKK
NVQTVSYETQGRSEEWKENVLRNQAIRTVKLPVSKRKSHKLVIKALDEGVVLDQIMLY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	20	775	8.8e-241	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	157	501	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.46e-16	666	778	32	159	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67466.1	0.0	1	778	1	778
ALJ47357.1	0.0	1	778	1	780
QRQ58823.1	0.0	1	778	1	780
SCV06764.1	0.0	1	778	14	793
QDM08765.1	0.0	1	778	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	0.0	21	778	20	774	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	9.91e-102	1	619	12	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	3.00e-96	23	619	19	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	3.06e-96	23	619	20	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.93e-94	59	616	58	607	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999067	0.000212	0.000142	0.000142	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04012.