CAZyme Information: MGYG000002470_02108

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_02108
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832	MGYG000002470_3|CGC14	95158.37	6.1559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 529621; End: 532119 Strand: -

Full Sequence      

MKTKFSWIFYCLVSLLLSQSLSAAERFVTNESNGFVWIQQGKAYPILVDSREDKGVVRAV
ANLQTDAGKVTGITPEIIHSVAGNRMLIIGSIENSSWIKQLLKAGKINAADLQGKREKYI
LQMVKQPMEGVDEAVVIAGSDKRGTIYGIYELSQQMGVSPWYFWADVPVEKHDIISIKEG
IYTDGEPAVKYRGIFLNDEWPCLGNWAGDTFGGFNSKFYETVFELVLRLKGNFMWPAMWN
SAFYDDDPMNGPLADEMGIVMGTSHHEPMGQAQKDWKRRGTGEWNYTTNGAVLRDFWQKG
MERCKDWEAVITLAMRGDGDEPMSEDANISLLQNIVKDQRKIIEKVTGKKAKETPQVWAL
YKEVQDYYDKGMRVPDDVTLLLCDDNWGNVRKLPDLKAKPRKGGYGMYYHFDYVGAPRNT
KWINITQIQRTWEQMMLTYEYGVRELWVVNVGDLKPMEYPITFFLDMAWNPGRFNENNLF
QHTVDFCKQQFGGNYAEEAARLIDTYTKYNRRVTPEMLNDRTYSLENYDEWRRVKDDYAA
LSLDALKLYYLMPAGYRDTFDQLVLFPIQACANLYDMYYAVAMNRKLAEENNVQANKWAD
KARACFERDSVLTYHYNHIMSGGKWNHIMDQTHIGYKSWNDPKHNIMPKVTFVPEPRIAP
APPVFVEKDGYVSIEAEHYTRSANSTSANWVTIPNLGRTLSAVTTLPTTAVPGADMYLEY
DFETEKSGDATVIVRFSSTLNFNDYKGLRYAVSLDGGEEQIVNINSDYKGELGKLQAEHI
ITTQTKHLLDKKGRHTLRIRPLDPALVMQKIMIDLGGLKPSFLGAPESLIKE

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	33	811	1.1e-289	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	185	517	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.13e-63	664	827	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	5.09e-04	72	152	49	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd02795	CBM6-CBM35-CBM36_like	0.007	673	800	1	109	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV05080.1	0.0	1	832	17	848
QDO71564.1	0.0	16	832	1	817
ALJ61511.1	0.0	1	831	1	831
QUT92919.1	0.0	1	831	1	831
QIU93956.1	0.0	8	831	4	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	3.40e-310	1	831	12	852	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	9.07e-284	35	828	17	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	6.55e-281	35	828	16	833	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.84e-221	46	828	25	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.36e-145	25	828	10	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999133	0.000177	0.000140	0.000133	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_02108.