CAZyme Information: MGYG000002470_02079

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_02079
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000002470_3|CGC13	72159.2	6.562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 471263; End: 473152 Strand: +

Full Sequence      

MLLFLLSAGIFIFRGSLLRHIADQRITLLEQRYGLDISYRELHMKGLNTIAIDGLSVVPQ
ERDTLFALQSLNVRIGLWKLMWGDIKIKEVRLDGLSLNFIKKDSIANYDFLFRTSAEPTS
PSEQSSSTDYTRRINTTLNLLFGLLPGNGELTHLTITERKDHNFVSFRIPRFVIDDYHFL
SEITVQEDSLNQQWNTEGEFNPSERRLYATLHAPQLTVPYINRRFGAEVQFDSLTCNFSQ
EKVSGGITRLVGQSEVRGLQVYHKRLSPETINLDRGQLDFYVNVSPQAVELDSASLVRFN
ALTFHPYFRAERVGEKTNQKEWHFTVSVRKPWFTSEELFGSLPKGLFENLEDLSTTGQLA
YHFLLDVDFSQLDSLKFESELKEKDFRILHYGKTDLGKMSGEFIYTAYENGQPVYTFPVG
PSWEHFTPLDSISPLLQMSVMQSEDGAFFYHRGFLPDAMREALIHDLEVRKFARGGSTIS
MQLVKNVFLNRNKNIARKLEEALIVWLIETEHLTPKARMYEVYLNIAEWGPMVYGIHEAA
DFYFAKRPSQLSIEESIFLASIVPKPKHFKNSFTTGGKLQESQEGYFRLIAERLAKKEVI
TDAQAAQVNINNVVLKGVAKSSFVSEGWQ

Enzyme Prediction     

No EC number prediction in MGYG000002470_02079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	421	572	3.1e-42	0.8418079096045198

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.82e-48	428	583	64	217	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	1.74e-44	410	569	1	156	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	1.46e-41	428	570	59	199	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.84e-37	428	607	80	253	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.33e-22	426	607	69	243	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71568.1	0.0	1	629	1	629
ALJ61545.1	0.0	1	629	1	629
QUT92885.1	0.0	1	629	1	629
ADV42290.1	1.25e-308	2	625	30	656
QUT72713.1	9.33e-271	3	626	18	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.32e-21	419	604	15	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.16e-20	419	604	15	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	6.39e-14	429	569	45	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3DWK_A	1.13e-13	409	569	13	170	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.75e-13	409	569	22	179	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7NS41	3.70e-29	426	599	61	227	Biosynthetic peptidoglycan transglycosylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=mtgA PE=3 SV=1
Q13U46	4.41e-28	426	599	72	238	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=mtgA PE=3 SV=1
B2JH09	4.46e-27	426	599	78	244	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=mtgA PE=3 SV=1
B2SYS3	2.48e-26	430	599	76	238	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=mtgA PE=3 SV=1
Q0AIQ0	9.36e-26	418	569	69	218	Biosynthetic peptidoglycan transglycosylase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.896778	0.099282	0.003036	0.000249	0.000168	0.000494

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_02079.