CAZyme Information: MGYG000002468_02976

Basic Information

• Species: Enterococcus caccae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus caccae
• CAZyme ID: MGYG000002468_02976
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194	MGYG000002468_21|CGC1	21374.07	9.7091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002468	3531321	Isolate	United States	North America

• Gene Location: Start: 24447; End: 25031 Strand: +

Full Sequence      

MKKTMLKAVLTLSLLVGGLSVSATVSHAHGYVSSPGSRAYFGSAQGGKINKNVGRAEWEP
QSIEATKNTFTPGKLASAGVSGFEPLDVQTTDRWHKSDITTGPLAINWTLTARHRTSTWD
YYMTKQGWNQNQPLDIKNFDLIGRVDDKATIPEASVNHTITVPSDRKGYHVIYAVWNVFD
TTNAFYQAIDVNVK

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	29	192	3.4e-47	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	3.98e-69	1	192	1	192	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	2.36e-60	29	192	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	6.07e-60	10	193	11	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	6.14e-49	29	191	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	0.001	89	190	35	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS38730.1	2.87e-138	1	194	1	194
ALS01708.1	3.61e-132	1	194	1	194
CCO09773.1	1.41e-97	1	194	1	194
QCJ35202.1	1.16e-96	1	194	1	194
AMR96071.1	1.16e-96	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A02_A	3.85e-90	29	194	1	166	X-raycrystallographic structure of EfCBM33A [Enterococcus faecalis],4ALC_A X-Ray photoreduction of Polysaccharide monooxigenase CBM33 [Enterococcus faecalis],4ALE_A Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction. [Enterococcus faecalis],4ALQ_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis V583],4ALR_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALS_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALT_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis]
5L2V_A	1.32e-47	29	193	1	164	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]
2BEM_A	6.00e-47	29	194	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	3.42e-46	29	194	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
6T5Z_A	8.85e-45	29	194	1	172	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S1	2.31e-97	1	194	1	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8EHY2	2.23e-44	8	192	8	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q6LKG5	3.28e-34	2	191	7	200	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
B5ESR7	2.44e-33	1	191	1	202	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q5E183	2.44e-33	1	191	1	202	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000324	0.998926	0.000195	0.000187	0.000163	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002468_02976.