CAZyme Information: MGYG000002468_02753

Basic Information

• Species: Enterococcus caccae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus caccae
• CAZyme ID: MGYG000002468_02753
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488	MGYG000002468_17|CGC2	55721.13	4.8767

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002468	3531321	Isolate	United States	North America

• Gene Location: Start: 46982; End: 48448 Strand: +

Full Sequence      

MSKSVFPENFLWGGATAANQYEGGYLSGGKELSTLDAITGGNHTTPRMITYKTKEGKIET
CTRGAALPEGAVGYVDPNQYYPSHVATDFYHHYKEDIALFAEMGFKCFRLSIAWSRICPK
GTMELNEEGLAFYDKVFDELLSYGIEPIVTINHFDIPMYLADELDGWSNRKVIDYFLFFC
ETVFKRYKDKVKYWMTFNEINFLRSWTQIGIHQNDQQAKYQAAHHLFVASAKAVKLGHEI
NPDFNIGMMVAYIPSYPMSCNPEDVMEAIKFNREQEFYIDVQVKGYYPAHKIKEFERKNV
VIKKEAGDDEIIKEGTVDYIGFSYYMSTVSAANPNEVKYVGGNQMPAVKNPYLQESDWGW
AVDPLGLRISLCKLYDRYNVPLFVVENGFGAIDKIEVDGTIQDDYRIDYFSKHVAAMSDA
IELDGVELIGYTPWGCIDLVSAGTGEMKKRYGFIYVDMDDEGNGTLERSRKQSFYWYKNL
IAANGMQE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	485	9.3e-146	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	485	2	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	485	1	470	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	485	1	474	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	3	488	1	457	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	487	1	476	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS37070.1	0.0	1	488	1	488
ALS02863.1	0.0	1	488	1	488
QGR81584.1	3.34e-316	6	487	3	484
QOG27780.1	6.68e-316	6	487	3	484
QCT93018.1	5.48e-315	6	487	3	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.03e-192	1	485	3	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.74e-191	4	485	5	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.95e-191	4	485	5	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.01e-185	4	485	5	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
6WGD_A	1.72e-181	6	485	8	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	1.39e-192	7	485	5	476	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	5.62e-192	1	485	3	476	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	7.13e-178	6	485	8	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.70e-177	4	485	2	470	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	5.78e-168	6	485	7	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002468_02753.