CAZyme Information: MGYG000002468_01856

Basic Information

• Species: Enterococcus caccae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus caccae
• CAZyme ID: MGYG000002468_01856
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
207	MGYG000002468_9|CGC1	23775.75	5.9398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002468	3531321	Isolate	United States	North America

• Gene Location: Start: 19082; End: 19705 Strand: +

Full Sequence      

MNSQRYKKKKVKKTNLPALFAGLLIVGVAFIFSINVLSDNSHIEEETAQQQEQVSKEQFI
DRISPHAKELQASYGVLPSIIIGQGILESNWGQSTLASKYNNLFGIKAYGEQKKVNLETR
EYINEEWIVIQGDFRVYNTWEESMDDHTRLFVNGVTWNPRLYEHVLLAKNYKQAAQALQD
AGYATDPTYADKVIHVIESYDLNQYDH

Enzyme Prediction     

No EC number prediction in MGYG000002468_01856.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	65	202	1.1e-38	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.05e-72	55	206	42	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	9.18e-41	55	199	151	296	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	1.94e-39	55	199	147	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
smart00047	LYZ2	5.50e-38	59	206	11	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	3.00e-37	55	207	319	473	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS38292.1	1.52e-144	1	207	1	207
ALS00888.1	3.68e-136	1	207	1	207
QZK93896.1	1.74e-101	6	206	11	212
AVR92389.1	1.74e-101	6	206	11	212
QWW15810.1	1.74e-101	6	206	11	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.68e-28	59	206	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.74e-19	59	198	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.46e-19	59	198	6	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	7.55e-19	58	206	62	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	5.23e-18	59	204	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.50e-50	8	206	3	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	7.52e-23	55	206	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	7.63e-23	5	206	11	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.96e-22	5	206	11	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P58231	7.39e-20	59	198	152	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999854	0.000143	0.000002	0.000001	0.000000	0.000038

TMHMM  Annotations     

start	end
16	38