CAZyme Information: MGYG000002468_01438

Basic Information

• Species: Enterococcus caccae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus; Enterococcus caccae
• CAZyme ID: MGYG000002468_01438
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000002468_6|CGC1	90941.81	6.6742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002468	3531321	Isolate	United States	North America

• Gene Location: Start: 76834; End: 79287 Strand: -

Full Sequence      

MKNSERIDKMTLTEKARLMSGASIWQTVALPALDIPALFLSDGPTGLRKQNGSGDHLGLN
ASIPSTCYPTAATIANSWDLELAETLGKYLGDEALEQEIDVILGPGLNTKRSPLCGRNFE
YFSEDPYLSGKMAAAYIKGIQANGVAACPKHFAANSQELRRMANNSVVDERALREIYLTG
FEIAVKEAKPKSIMTAYNRINGIYANEHHYLLREILKDEWGFDGFVVSDWGGSNDHVEGV
KNGSHLEMPGTGNAGALEIVEAVESGILAETILDERIDELLSVTLDIHEQKQTQHVKTTS
EQRNAFAQKAAAQSIVLLKNNHETLPLKELEKVAIIGDFAKVSRYQGAGSSLVNPTKVDT
IVNAVQEYDLEIAGFAQGYDRKNKMDNGLVMEATAVAMKSDVILLFMGLTEISEVEGLDR
EHMKLPKNQEVLLHELAKLNKKLVVVLSGGSAIEMPWLEKVDAVIHCYLGGQAGAHGALD
VLTGKVNPSGKLNESYPISYSDTPAAYYYPGKEYDAEYRESIFVGYRYYDKVKKSVLFPF
GFGLSYTNFSCTDFVVTEQGISCSVENNGKLDGAEVLQLYIGKKDSAIFRPTKELKGFKK
IFLKKGERATVTIPFDAYTFRCFNPESNQWEIEAGEYLISVGTSSQDITFETTIMRQGVT
LQPFYDKAKLAPYFSGEVNRLSKADFEILYQHEITGSMWNREKDLGMNDTLSQMFYAKSR
LARGIYRVLTRIKDKSVEKGEPNLNILFNYNMPFRAMAKMTGGNISQSMVKAILLIVNGH
FFKGTNRLLKDFFLNNKVKKRQDLSKLERNLEGGKRK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	248	1.5e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.28e-84	26	649	95	758	beta-glucosidase BglX.
COG1472	BglX	5.59e-67	23	342	48	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.66e-56	315	526	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	4.40e-56	10	654	60	777	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.02e-38	26	283	57	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29197.1	0.0	5	800	6	802
AWX98541.1	6.34e-318	1	800	1	796
AWX96411.1	6.34e-318	1	800	1	796
QZS52358.1	6.34e-318	1	800	1	796
QZS61993.1	6.34e-318	1	800	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.35e-206	7	654	9	666	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.01e-170	7	658	9	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.75e-132	2	653	3	710	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.18e-131	2	653	3	710	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	5.28e-120	7	648	10	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.29e-205	7	654	9	666	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.58e-167	7	658	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.84e-165	7	658	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	2.77e-128	5	651	48	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	5.67e-125	7	663	15	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999936	0.000083	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002468_01438.