CAZyme Information: MGYG000002466_00912

Basic Information

• Species: Yersinia frederiksenii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia frederiksenii
• CAZyme ID: MGYG000002466_00912
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000002466_2|CGC6	53465.38	6.1652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002466	4803605	Isolate	Finland	Europe

• Gene Location: Start: 402204; End: 403613 Strand: +

Full Sequence      

MQEASLLKHLTLAVMRGQIRASQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LDCRHGSKYWGHWRSTDLVHWEHQPVALVPSEAYESHGCYSGSAVIADDLITLIYTGNVK
YPDGSRTAFQCLAQENDRGEFDKLGPVLPLPAGYTGHVRDPKVWQHNGQWYMVLGAQDLQ
RQGKVLLLRSDDLHQWQNLGEIAGSNLGGLGPFGYMWECPDLFRLAERDILIFCPQGIPA
EAERYRNTFQAGYLLGQLDYTHATFSHQDFHELDAGFEFYAPQTTQAADGRRLLFGWMGI
PDEDELYQPTVAYGWIHTMTCPRELSLQGDRLIQQPARELTALRREHRQWQGPAHDAPHF
PISSAEIIVNVSAPFTLELGHKLMLEWDGARITLSRNNLRTGGREFRYWRGQLHQLQLLC
DRCSIEIFINQGEAVMTSSYFPAEPPQAIFTGSAELCLQHWLLSSPMIE

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	336	2.8e-100	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	0.0	14	443	1	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	2.17e-172	37	329	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	1.66e-168	23	465	25	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	1.04e-144	31	336	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	9.82e-132	31	432	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM97299.1	0.0	1	469	1	469
QHB31317.1	0.0	1	469	1	469
AJJ12349.1	0.0	1	469	1	469
CCQ42089.1	0.0	1	469	1	469
ALG43737.1	0.0	1	469	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	7.38e-82	17	450	19	467	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.07e-80	26	441	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.64e-79	26	441	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	7.34e-62	18	449	24	470	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	2.69e-55	27	434	3	399	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27217	5.01e-192	5	469	5	466	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	1.03e-186	5	469	5	466	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1
P07819	1.43e-144	21	463	23	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
A1STJ9	5.62e-107	27	469	96	545	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
Q56660	2.55e-105	25	441	92	511	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999842	0.000195	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002466_00912.