CAZyme Information: MGYG000002465_02277

Basic Information

• Species: Yersinia massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia massiliensis
• CAZyme ID: MGYG000002465_02277
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	MGYG000002465_13|CGC2	23657	10.0407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002465	4872451	Isolate	Finland	Europe

• Gene Location: Start: 61825; End: 62487 Strand: +

Full Sequence      

MNPKVGCLMAILLLAGCAKQTPPPQASNGWLKKAPQSGFLNAPKSSAGSTTVAYSDVIKQ
AASHYGVDETLIKAIIQVESGYNPDVVSTSNAVGLMQIKASTAGRDAYRMKGRNGQPSSG
ELKDPVKNIDIGAAYINILQNQQLAGINDPQTLRYATIVSYANGAGAMLRTFSSDKRLAV
NKINSLSPNEFYQHIQKKHPAAQAPRYLWKVDTAYRAMSE

Enzyme Prediction     

No EC number prediction in MGYG000002465_02277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	70	218	1.6e-19	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	4.17e-87	58	216	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.67e-78	11	218	10	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	6.20e-71	54	216	192	357	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	3.83e-31	22	216	107	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	8.94e-30	58	183	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVX38037.1	9.09e-157	1	220	1	220
QKJ12822.1	9.09e-157	1	220	1	220
ATM86078.1	9.09e-157	1	220	1	220
QHB32465.1	2.92e-153	1	220	1	220
CAL11985.1	2.92e-153	1	220	1	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	1.08e-64	57	220	25	188	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	3.07e-64	57	220	25	188	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	3.07e-64	57	220	25	188	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	3.07e-64	57	220	25	188	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]
3T36_A	4.09e-64	57	218	42	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5XQ85	5.95e-66	8	218	7	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=emtA PE=3 SV=1
B7LSJ1	5.95e-66	11	218	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
A7MKC3	1.19e-65	11	218	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A8AFS5	1.19e-65	11	218	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B7UQ77	2.40e-65	11	218	10	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002465_02277.