CAZyme Information: MGYG000002459_01389

Basic Information

• Species: Bifidobacterium animalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium animalis
• CAZyme ID: MGYG000002459_01389
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000002459_1|CGC21	33940.69	6.8265

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002459	1958651	Isolate	China	Asia

• Gene Location: Start: 1628100; End: 1628993 Strand: -

Full Sequence      

MRCAGIVTYNPDLERLRANLNNTASQVDAVFVFDNGSENVADIRSLADSEYTTLRVEADP
NNRGIAFALNRLLDAAKEHGFKHMLLLDQDSVPTEGMCDELERHLTGSVALVCPFILDRN
RMTEEEWQAQKMPPLERLTHAAKHGAITSGSLVDVAAALEVGGFDDNLFIDYVDFDFNER
LILNGYEIVKDNTVYLLHEKGKSERTWLKVPRNTSAGVQWQPLYKLGYSPMRCYYQSRNR
IVYWKKYHRHTGGEGLTEIPLLMALSLLFENHRIAKLRAYSRGIHDGMKMKIVEYRK

Enzyme Prediction     

No EC number prediction in MGYG000002459_01389.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02526	GT2_RfbF_like	4.04e-55	4	241	1	234	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
TIGR01556	rhamnosyltran	1.82e-31	7	287	1	281	L-rhamnosyltransferase. This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG1216	GT2	5.99e-23	3	247	6	282	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.75e-09	6	199	3	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	0.001	6	189	3	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA33368.1	8.29e-221	1	297	1	297
AEK30851.1	8.29e-221	1	297	1	297
QPB50527.1	8.29e-221	1	297	1	297
AJD34498.1	8.29e-221	1	297	1	297
ACS48300.1	8.29e-221	1	297	1	297

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37782	3.44e-10	4	265	7	250	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002459_01389.