CAZyme Information: MGYG000002455_02222

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_02222
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002455_8|CGC5	43391.44	6.2518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 298856; End: 299983 Strand: +

Full Sequence      

MKKKLIGVFLLMSLVCGSISAQGLPDRKETLETLIKVNNYFMKKYADYRTPSYNGIIRPS
NIWTRGVYYEGLMALHSVFPREEYYDYAYQWADYHKWGMRNGNTTRNADDQCCGQVYIEL
YNICPDPEMIKNIKVNIDMVVNTPQVNDWWWVDAIQMAMPIYAKLGKLTGERKYTDKMWE
LYSYTRNEYAKNGLFNPKDGLWWRDHDFVPPYKEPNGEDCYWSRGNGWAYAALVRVLEEI
PADEVHRTDYVNDFLAMSKAIKKCQRKDGFWNVSLHDETNFGGKETSGTALFVYGMAWGV
RNGLLDKKEYLPVLLKAWNAMVQDAVHPDGCLGYVQGTGKEPKDGQPVTYDKIPDFEDYG
IGCFLLAGTEVYKLN

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	373	5.8e-93	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.72e-111	36	374	4	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.72e-50	41	374	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92974.1	1.66e-298	1	375	1	375
ALJ61451.1	9.59e-298	1	375	1	375
QDO69334.1	2.77e-272	1	375	1	375
QRM98498.1	4.82e-242	1	375	1	379
QUT32919.1	4.82e-242	1	375	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.47e-72	15	370	18	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.10e-64	20	370	2	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.90e-48	149	375	152	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	9.55e-17	59	374	35	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.97e-16	59	374	25	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	3.49e-51	63	375	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	3.16e-47	149	375	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.30e-37	107	375	135	412	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	5.23e-16	59	374	35	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000856	0.717600	0.280695	0.000288	0.000280	0.000246

TMHMM  Annotations     

start	end
5	24