CAZyme Information: MGYG000002455_02209

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_02209
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948	MGYG000002455_8|CGC5	107972.77	7.1149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 270116; End: 272962 Strand: +

Full Sequence      

MNIKCYYSVLLLIQLFLINSINALASDSINVNNNSFFSFDEQIVNGTTGTPLGGFGCGAI
KFDANTGTFSAMTVPPADAYDFKNVADAQFQLFTNRNGQIETRNILKAILTHGRPNDDAI
WPLHKVDFGSVNGVRIELTGISPLDNKDYTNMHLPYALYEISLTNMESSDVISAFALKWN
SESAPFFSLPAKGIYSDEWSILVKTSHSKAGVSVGDDKENRFLRSGVCSSSQEQAHTGKV
AVKMNLLPHETQKIYFVVAWYDRTDPEIGYYKNLYKTPRAIAEHGLKVFSKLKYNAEKLV
TGMRASNLPGWLKNQTLNTLVNVVTNSMYKKDGRVAFAEGQWTCFGTMDQMWLARQIMYM
LIPYYAWQELAYWARTQMKNGQIHHDFNVMSVGKEREKRSVLVSWDDTEHIDYRNIQKWV
DLNCGFIISVFEIYRATADRKQFDLLWPYVKKAAQRILDQVEQYGSTKYPFTFDGSENSY
DAGGNPDPYNSNLSAVAYKMMIQLAGEKGEADLVKLYENAYKMVVNSFHNRYIRDGQFVA
GKHCESIFAGQWLAFHLKLGEIWKAEDTDFILSKLENYYYPYYRGLGYPEGTYDEWSPYI
LAHYGGLLLNTGRLDQWHAMQKDSYLRQYLDRDRVFDHPLNILPLVNEPKWVSTNIKSKK
QYISIPAMWRNYYDIVGFHRDFRSKELWIKPIIPKTMNHEMKNAMFISPEGYGCIDCKES
GEYMQDKEIVIRTESPMPVSTLYLSDNFEENISVTINGKKYPFTRIGSGYAKEIAVRWNG
KITEKGIRIVVKGTPEKKVIPIPVKPVTGVISNSSINQMSPYETMEAENADKLAGTSIVQ
SNKGNRYVTSCNNFDYIQFSNIDFGKKGATQLKIRVSGLSENSEIEVVLDDTSGTVVGNC
KVPATGGEEVWVELECPVGKITDIHNVVLRFYGNSSDNLMNIDWIRFK

Enzyme Prediction     

No EC number prediction in MGYG000002455_02209.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	823	948	4.9e-25	0.8840579710144928

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	1.97e-36	824	947	2	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam03422	CBM_6	1.63e-25	826	948	1	124	Carbohydrate binding module (family 6).
smart00606	CBD_IV	9.75e-23	821	947	4	129	Cellulose Binding Domain Type IV.
COG4354	COG4354	2.42e-14	49	598	14	635	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
cd02795	CBM6-CBM35-CBM36_like	2.86e-07	824	947	1	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92987.1	0.0	1	948	1	948
ALJ61438.1	0.0	1	948	1	948
QBI01799.1	0.0	44	947	41	942
QBE66570.1	0.0	44	947	51	945
QCP10011.1	0.0	44	947	40	941

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V4V_A	1.53e-16	820	948	2	128	CrystalStructure of a Family 6 Carbohydrate-Binding Module from Clostridium cellulolyticum in complex with xylose [Ruminiclostridium cellulolyticum]
1W9S_A	8.02e-12	812	948	2	139	ChainA, Bh0236 Protein [Halalkalibacterium halodurans],1W9S_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans],1W9T_B Chain B, Bh0236 Protein [Halalkalibacterium halodurans],1W9W_A Chain A, Bh0236 Protein [Halalkalibacterium halodurans]
1GMM_A	2.73e-08	820	947	2	126	ChainA, CBM6 [Acetivibrio thermocellus],1UXX_X Chain X, Xylanase U [Acetivibrio thermocellus]
1UY1_A	4.16e-07	822	933	21	132	Bindingsub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium],1UY2_A Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium],1UY3_A Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium],1UY4_A Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry [Thermoclostridium stercorarium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45796	4.47e-17	814	947	370	507	Arabinoxylan arabinofuranohydrolase OS=Paenibacillus polymyxa OX=1406 GN=xynD PE=1 SV=1
P10478	1.41e-09	825	947	301	419	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P33558	6.86e-06	752	933	188	361	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2
Q8GJ44	7.86e-06	752	933	187	360	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000206	0.999181	0.000157	0.000139	0.000133	0.000130

TMHMM  Annotations     

start	end
7	29