CAZyme Information: MGYG000002455_00346

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00346
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000002455_1|CGC9	50533.55	4.8504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 466409; End: 467803 Strand: +

Full Sequence      

MRYATIGILLLAWVLLACDEKEEVSGPSVPFPDYGEVLAFPGAEGYGRNAVGGRHGEVYH
VTTLADSGKGSLRDAVSKPGRIVVFDVAGIIRLQSPLAFSKNLTIAAQTAPGDGIVVYGN
HVSFSGADNVICRYLRIRMGVNGKDGKDAAGVAYGANMIFDHMSVTWGRDECFSINVDPK
KPGDQPRNITIQNSFIGQGLQPHSCGGLIQTTAENGVTLYRNLYIDNKTRNPKVKGLNQF
VNNVVYNWGNGGAYIMGDTEQTSEADIRNNYFIVGATLNYDGKTLGATAPFTRYNEHFRA
HLSGNYYDENKDGVLNGRELTREDCTKRKQESGTEVVITPTFLDKPSDVHPTVEGLMTAR
DAYEWIVQHGGASLPARDQVDSYLVEELTSLGMKGGIILTEMDLPTQGPGEIKSGTKPLD
TDNDGMPDDFEDAYGLDKNDPSDAMKIASNGYTNIENYIFLINK

Enzyme Prediction     

No EC number prediction in MGYG000002455_00346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	88	272	6.2e-54	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00544	Pec_lyase_C	3.49e-04	125	272	57	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90499.1	0.0	1	464	1	464
ALJ58382.1	0.0	1	464	1	464
QUT89622.1	8.37e-201	8	463	15	482
QNL41166.1	6.84e-169	4	458	9	503
QUT83146.1	2.67e-168	4	458	9	502

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	1.55e-135	37	456	20	407	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.77e-134	37	456	20	407	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	4.39e-130	37	456	21	408	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	6.22e-130	37	456	21	408	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	6.22e-130	37	456	21	408	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000063	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00346.