CAZyme Information: MGYG000002454_02131

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_02131
• CAZy Family: GT8
• CAZyme Description: General stress protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000002454_1|CGC33	36744.82	7.2693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 2523205; End: 2524152 Strand: +

Full Sequence      

MNIVYATDDNGALGTGVSIVSLMENLPLGVHADIYIMTDGLSGDNTARFHSLQQDYNLHL
HFIDMKDKYTDFPVGSKWSAATYYRLGLAGELPATVERALYVDIDTIFNRDISPMYESEF
GDCLIAGVFTTEDLSEESFSRWKREMNLDRDSIYINAGVILYHIGRIREERFESQVFSWA
KNNIHRLSWQDQDILNVCYQQRILLLHPMWNICDGAIWSIRWEGVTSFRNNPLKPADLLE
AARRPGIIHYWGHPKPWHPNSIRQDYGLFYKYWKKSPWKDDIRDFRKQNDPGRMFISKMR
CLLGKGKRLLQGKHQ

Enzyme Prediction     

No EC number prediction in MGYG000002454_02131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	258	2.6e-47	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	6.94e-60	1	258	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	4.15e-38	1	281	3	269	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	7.78e-37	2	258	1	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	3.60e-21	1	258	1	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
PRK15171	PRK15171	6.99e-21	1	280	26	293	lipopolysaccharide 3-alpha-galactosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE98970.1	5.76e-246	1	315	1	315
QTF05907.1	5.76e-246	1	315	1	315
QTF03595.1	5.76e-246	1	315	1	315
QWP19884.1	5.76e-246	1	315	1	315
QWP10736.1	5.76e-246	1	315	1	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	2.91e-20	3	273	8	267	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
1SS9_A	6.68e-20	1	258	1	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	1.15e-18	2	258	2	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27129	5.01e-23	1	281	28	296	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19816	1.04e-19	2	278	29	293	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27128	5.59e-17	1	280	29	297	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19817	1.20e-15	1	280	26	293	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
Q9AEU2	6.68e-06	97	271	106	254	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_02131.