CAZyme Information: MGYG000002454_01906

Basic Information

• Species: Akkermansia muciniphila
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila
• CAZyme ID: MGYG000002454_01906
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	MGYG000002454_1|CGC29	87735.39	9.3464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002454	2762447	Isolate	China	Asia

• Gene Location: Start: 2258501; End: 2260903 Strand: -

Full Sequence      

MNTYIYGPKDDVFHGFSKRWREPYPADMAKDLKELVKVAKQNKVNFVWAVHPGADIHWGE
ADRKAAVKKFEMMYDLGFRSFAVFFDDIGGEGAKPEGQVEFLNYLNKEFIHKKPDVTPLI
VCPTAYSGGGSRYHEVMGEHLDKDIGIMWTGSSIVSDIRTPALKGINKYLKRPAFIWWNF
PVTDYVRHALFLGRTYGVDADAMPFMQGFASNPMDKPEASKISLFSVANMTWNAKAYDSD
RTWKDSIRILFPGCSSAMQTFSDHNSDGGPSGHNYRKEESVEIAPVVEQVLELCRRGARV
SGSKAFDRLKAEFAKIAQAPAAIRAKSNNPAFVAEVEPWLIQFESLGKAGVNSMRMIEAT
EVGNAAGALNHAMEAACLLAEMQRYSREISKAINKHVTEVTKKNSPWQTAVKPSELVMAP
AVRELLDMGSTPVLSRVSGQAVGRVKPYVSTKSKIGIEKMLDDDPESFYYCKEVQKKGDF
FGVDLGVPREIRTVSIVMGRNDSDTDAVNRGQLEVSLDGQSWSPLMPESSGLRVEYRGNG
KKGRFVRYRATAQGVPGGKPDVWTAIRDFKVNAPAAPSVLTDAPAFRNAVVEAGDRDISL
KRIMEVHPLPPKKFLGLQIPAGASVESASVNLKTPDMKWAKLFISMDGKSWTEVSLKEDG
SADIGGVIKGIRLLNASSSPQEVTLEEFRLNLANKGGKSADSGAAGDFNLATFLPVELSP
ERAEIPCDFPRAGSVIVLSDGKEASVLACGADGRWVPVGNLAKGRKVNTFSLKSVKKPVR
ALGLTGKKGSSVNIFEVVWK

Enzyme Prediction     

No EC number prediction in MGYG000002454_01906.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	1	262	2.9e-84	0.8983050847457628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.71e-124	1	261	29	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	3.03e-07	456	558	13	120	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	8.73e-04	469	525	36	92	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV48184.1	0.0	1	800	1	800
QTF03390.1	0.0	1	800	1	800
QTE98765.1	0.0	1	800	1	800
QTF05702.1	0.0	1	800	1	800
QTF01079.1	0.0	1	800	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J4G_A	9.43e-110	1	548	157	693	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	9.67e-110	1	548	158	694	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	9.67e-110	1	548	158	694	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
7K41_A	1.04e-109	1	548	161	697	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
5ABF_B	1.25e-109	1	548	168	704	Structureof GH84 with ligand [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	9.00e-109	1	548	179	715	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	5.16e-56	1	525	210	715	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	5.16e-56	1	525	210	715	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	1.11e-33	1	698	215	954	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.32e-27	1	232	90	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002454_01906.