CAZyme Information: MGYG000002449_02927

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_02927
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000002449_39|CGC2	26860.7	8.0603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 35780; End: 36532 Strand: -

Full Sequence      

MNRNKLFVSVIGLLVFVASLSAKDYQVSMFGIKSDGVTLNTRSIQRAVDYISGQGGGRLV
FYVGRYLTGSIELKSNVTIRIEEGAALVAVPSVYDFKGTNGCNALIYANKQKNIGIGGKG
IIEGRNKAVRTSIEEQLQKGHIKGNVSDYAPALICLDGCEDVKVEQITLQDACNTAGIYK
DCRNVTIDKVVVNAQTSESNAVSISGCDGMKMTDCYFNMVVEPLQTAGTSRNLTFTNCLT
PDGKAVSTDK

Enzyme Prediction     

No EC number prediction in MGYG000002449_02927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	54	240	1.1e-21	0.5384615384615384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	7.37e-19	27	249	85	348	Polygalacturonase [Carbohydrate transport and metabolism].
pfam12708	Pectate_lyase_3	0.002	30	79	7	58	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDN88021.1	2.76e-150	1	250	1	250
QUT49881.1	7.92e-150	1	250	1	250
SCM56501.1	4.33e-68	4	244	2	243
BBD44717.1	7.01e-67	14	250	12	249
BCG53463.1	1.97e-56	17	250	18	252

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MXN_A	1.27e-135	23	250	20	247	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]
3JUR_A	1.38e-10	30	124	33	135	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	6.12e-10	23	123	43	153	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	6.09e-07	18	137	148	286	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	3.73e-08	18	216	54	266	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	1.03e-06	23	191	150	364	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.998987	0.000201	0.000164	0.000163	0.000158

TMHMM  Annotations     

start	end
5	22