CAZyme Information: MGYG000002449_02083

Basic Information

• Species: Parabacteroides acidifaciens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides acidifaciens
• CAZyme ID: MGYG000002449_02083
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000002449_21|CGC1	43420.97	7.3206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002449	5100482	Isolate	not provided	not provided

• Gene Location: Start: 20998; End: 22113 Strand: +

Full Sequence      

MKTKFFIPLACLLFFTQCATSSKSDFDNFPEGYTPKEVGKLVSKRFISTKHMFHNKNGKD
GIHYAEVCTWYGALKYATVTKDNELFKQLQNKFEPLFTTEADYRPLMYHVDLNMFGCLPL
EFYQITNDKRYLDMGMPYADTQWQVPDSATAKEKEWAEKGFSWQTRLWIDDMFMITIIQS
QAYKSTGKREYIDRAAREMVMYLDELQRPNGLFFHAPDVPFFWGRGNGWMAVGMTELLRY
LPKDNKDRPRILEGYLLMMKSLKEYQLPGGMWNQLIDDPECWPETSGTAMFTYAMITGVK
SGWLDKKEYSPVVHKAWMALVPYINKEGDVTEVCVGTNKKNDKQYYYDRRRIAGDYHGQA
PVLWCCFALME

Enzyme Prediction     

No EC number prediction in MGYG000002449_02083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	56	369	2e-75	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.27e-51	40	365	3	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.46e-43	59	363	31	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT51085.1	2.92e-223	52	371	1	320
QPH40458.1	2.57e-189	3	371	7	366
QDW23918.1	2.66e-189	9	371	6	367
QDO68157.1	2.07e-186	1	371	1	367
ALJ59885.1	6.87e-185	1	371	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.08e-34	167	364	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
5NOA_A	1.91e-22	168	320	158	324	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
1NC5_A	6.08e-22	63	363	40	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.57e-21	63	363	30	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	4.58e-21	168	317	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.33e-21	63	363	40	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	6.56e-19	4	330	3	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	5.56e-18	122	330	122	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	3.25e-17	168	346	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	1.97e-09	184	363	11	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000026	1.000022	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002449_02083.