CAZyme Information: MGYG000002441_00347

Basic Information

• Species: Rubneribacter badeniensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Rubneribacter; Rubneribacter badeniensis
• CAZyme ID: MGYG000002441_00347
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000002441_3|CGC1	42948.48	4.5005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002441	3364395	Isolate	Germany	Europe

• Gene Location: Start: 124735; End: 125886 Strand: -

Full Sequence      

MDGVWYCSDENGVLRKGWYDEGGRRYRLDRDDGHLWTGSFTVDGVWYHALPDGEVYSGWI
DGSDGGRYYYDPAKGGALALGWFAVDGGRYYASPDGSLVRGWYDEGGRRYRLDRDDGHLW
TGWYTVDGVWYCSDENGVLRKGWYDEGGRRYRLDRDDGHLWTGWYTVDGVWYCSDENGVL
NGGWQLNGIYYYYYNSNGELVPSKTQELYYVAGDCVVSPEKMVDAFRMSGAAYPSVDLAK
GGAPTIDDFCRIVYEEATAEGIRSQVVFCQAMLETGWLRFGGDVSIGQFNFAGLGAVGGG
ASGASFPDVRTGIRAQVQHLKAYANSELLVKECVDPRFSYVQRGVSEYVQWLGIPNNPQG
KGWAASDGYGMNIVEMLMRYGLW

Enzyme Prediction     

No EC number prediction in MGYG000002441_00347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	252	382	4.6e-19	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	2.68e-29	17	213	444	638	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	4.90e-28	37	228	486	676	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	5.67e-26	2	201	469	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.65e-25	2	201	492	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	4.26e-22	71	211	501	640	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB24702.1	2.73e-65	209	377	86	254
QEI32209.1	2.73e-65	209	377	86	254
QRT30849.1	2.73e-65	209	377	86	254
CBL26238.1	3.20e-65	198	379	71	252
CBL19417.1	1.45e-62	205	377	51	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.47e-16	246	379	68	194	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002441_00347.