CAZyme Information: MGYG000002439_03696

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_03696
• CAZy Family: PL17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	MGYG000002439_19|CGC1	73569.94	5.2374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 79650; End: 81557 Strand: +

Full Sequence      

MNYVNENFDRLINSVEENRKIIEAMRADVDGFMPGFTDSPERLSRWGHYYFCDDDGGRLI
FDLNSPKKHRCEVCGKVYENEILDGVWTYFYRNRAVVMALVSAVVYKATKEKRYFDYAVQ
VMDFYASHYQEFVLHNKENDICDSYDTMSWGCGKMMPQGLNESIVAIRFVQTIEILKDEL
SAEWLDMVHRKMFKEMFHLLAPQATRIHNISCWNLSAIGVMGLAFGDQEMIDFTFNSEYN
IHEQLKRGVTSDYFWYEGSIHYNFFLLEGISYLYLFSRIYDYDFGEESGRILTNMFVQAY
FYAFDNQYLPNPNDGWPNLNLKTFSYIYHTAARAAGEDSEIGNITKIIESSEEPRTILPL
SEPYYCQNKVCLEQLLFNIDFDYSRFIPVKKGSCNFPKSNFAMLRNKNWNVFMKYGLNGK
SHAHPDIMTVEMMYKDHRVSRDLSNAGYRSKLCNEWHRKTLSHNTVCFNGTDITSVSPGE
CLYFDDSKVTARAKDVYEGIDYTRTIELGENCVEDTFSVSGGKDGIYDYIFHFESDFSFE
HELELEDGDLGFDKNGYQHVLEVKKAKACGDSAVLYGSAGDNKFKVTVDLKGHQLYLLKT
MDNPVNKIRYSILVRHAGADPQYHLSIKEAGNEAV

Enzyme Prediction     

No EC number prediction in MGYG000002439_03696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL17	399	509	3e-25	0.9640287769784173

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	2.36e-10	396	537	9	168	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR73164.1	0.0	1	627	1	628
BAR73169.1	0.0	1	627	1	628
BAR73168.1	0.0	1	627	11	638
ADL02748.1	0.0	1	627	1	628
QRV19036.1	0.0	1	627	1	628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BM6_A	3.62e-15	84	631	79	652	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BM6_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]
7BJT_A	8.31e-15	84	631	79	652	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BJT_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]
4OK4_A	1.58e-12	102	625	99	634	CrystalStructure of Alg17c Mutant H202L [Saccharophagus degradans 2-40],4OK4_B Crystal Structure of Alg17c Mutant H202L [Saccharophagus degradans 2-40]
4NEI_A	6.28e-12	102	625	99	634	Alg17cPL17 Family Alginate Lyase [Saccharophagus degradans 2-40],4NEI_B Alg17c PL17 Family Alginate Lyase [Saccharophagus degradans 2-40]
4OJZ_A	1.89e-11	102	625	99	634	CrystalStructure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OJZ_B Crystal Structure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OK2_A Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40],4OK2_B Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FSW8	1.14e-11	88	560	92	586	Alginate lyase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt2602 PE=1 SV=1
Q21FJ0	3.44e-11	102	625	99	634	Exo-oligoalginate lyase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=alg17C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_03696.