CAZyme Information: MGYG000002439_03557

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_03557
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36419.84	6.2205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 57841; End: 58818 Strand: -

Full Sequence      

MIHISKGGGGDFSTVQAALDSIPVDNKEEMILFIHKGIYEEQITVKPPHITFIGAGETPN
DTVLTYGLSARQLMPDGTKRGTFRSYSCLIDTHDFKACNLTFQNTAGNADEAGQALALYV
DGDRLHFQNCRFLSGQDTLFTGPLPPKEIEPGGFIGPKQYSERINGRHLYDHCYIEGDID
FVFGSATAYFDECTFHSTPIDRTINGYVTAASTAQGQAYGYVMNNCRFTSASCPAHSVYL
GRPWRNFAKTVLINCYMGPHIHPEGWHDWNKPEARDTVFYAEYQSYGPGADMERRPDWVV
RLKSEELCYYSKKAVLSGREGWNLK

Enzyme Prediction     

No EC number prediction in MGYG000002439_03557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	317	1.1e-94	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.48e-87	9	318	91	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.45e-67	4	298	4	274	Pectinesterase.
PLN02432	PLN02432	6.76e-66	1	320	12	290	putative pectinesterase
PLN02682	PLN02682	5.62e-65	6	306	76	351	pectinesterase family protein
PLN02773	PLN02773	3.50e-61	1	306	6	286	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	5.44e-161	1	323	1	320
QRP39805.1	1.64e-134	2	323	18	348
ASN95501.1	1.64e-134	2	323	18	348
ANU50094.1	4.51e-134	2	323	17	347
QQR01004.1	4.51e-134	2	323	17	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	4.87e-40	2	298	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.06e-36	4	298	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.82e-32	1	294	7	315	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	3.94e-29	9	290	41	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	6.44e-28	4	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FM79	3.64e-55	1	307	81	363	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LVQ0	2.61e-52	1	310	6	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9SIJ9	9.55e-47	1	320	50	330	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q8VYZ3	1.95e-46	6	320	90	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
B2VPR8	1.44e-44	1	306	66	339	Pectinesterase 2 OS=Olea europaea OX=4146 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_03557.