CAZyme Information: MGYG000002439_01596

Basic Information

• Species: CHH4-2 sp002899675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CHH4-2; CHH4-2 sp002899675
• CAZyme ID: MGYG000002439_01596
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000002439_6|CGC1	43678.71	4.7849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002439	6089737	Isolate	Taiwan	Asia

• Gene Location: Start: 65287; End: 66411 Strand: +

Full Sequence      

MEILDRYIHQLLEKSTPEAPIWYKEEIGTDGHSGWNYMDGCMIKAILELYHITQNSLYLE
FADHFIDHFVREDGSIVSYDPKEHNLDNVNAGKTLFDLYKLTGKEKYRKGMDTVYSQLKE
QPRTSTGNFWHKEIYPNQIWLDGLYMAQPFYMQYEVEYNGCKNCMDIISQFRNVHKLMRD
SRNGLYYHAYDDSRSMFWCDKVTGLSDNFWLRALGWFAMALIDTMEIMPKTMIAEKEELN
QIYRDLIDSMLPYQDEETGMWYQVVNRGGIAPNYLETSGSAIFAYAIMKSVRLGYLPESY
RAFGEKAFYGTCEKYLSEENGELQLDGICLVAGLGNVEHREGTFDYYMREPVVKNEAKGV
APLILAYIETMMIK

Enzyme Prediction     

No EC number prediction in MGYG000002439_01596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	33	370	6.5e-109	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.63e-89	24	369	25	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.47e-81	34	369	26	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU47524.1	5.05e-220	1	371	1	371
QQR03578.1	5.05e-220	1	371	1	371
QIX91776.1	1.02e-219	1	371	1	371
QJU22745.1	2.39e-218	1	371	1	371
QRP36827.1	4.82e-218	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.05e-100	35	369	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.76e-66	35	369	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.41e-66	35	369	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.39e-10	27	324	57	340	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.39e-08	27	313	58	331	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.62e-66	35	369	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.36e-44	146	373	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.36e-44	146	373	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002439_01596.