CAZyme Information: MGYG000002438_03273

Basic Information

• Species: Parabacteroides distasonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides distasonis
• CAZyme ID: MGYG000002438_03273
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000002438_2|CGC9	65279.4	5.9065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002438	5030699	Isolate	South Korea	Asia

• Gene Location: Start: 476904; End: 478652 Strand: +

Full Sequence      

MRKKLIILFIGIGSFTLFAQQRDHRTREYIAPVRIVWQQDSSRITGANHLLVPGNGQSDL
ANNRLCVLKSTPTEHPALLLDFGKELQGGLQLVTGMPPSHDPVSVRVRFGESVSEAMCEI
DGANGASNDHAMRDFVVSLPWLGVQEIGNSGFRFVRIDVLGDSTELQLKEVRAISTFRDI
PYLGSFRCNDERLNRIWKTGAYTVHLNMQEYLWDGVKRDRLVWVGDLHPEVMTVSTVFGY
NEVVPKSLDLIRDITPLPSWMNGISSYSIWWLLIQRDWYYYQGNLAYLQEQRSYMTALLR
HLISKVDPSGQERLDGNRFLDWPSSENTPAIDAGLQSLMIQAMRAGEELCTVLGEDALAS
ECRAVASKAIEFSLRKKSRFPSEKDRITPGDKQAAALMALAGIMDAKEANERCLAVDGAK
GFSTFYGYYMLRAMALAGNYQGALDVIRTYWGAMLDVGATTFWEDFNMEWLPDAGRIDEL
VPAGKKDIHGDYGAYCYQGFRHSLCHGWASGPTSWLSEYVLGVQVVEPGCRTVRIIPHLG
DLEWVEGTFPTPYGVIEIRHEKGADGKVISHINAPEEIRVTP

Enzyme Prediction     

No EC number prediction in MGYG000002438_03273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	76	579	8.6e-104	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.57e-21	184	520	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.07e-06	522	568	1	47	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT19201.1	0.0	1	582	1	582
BBK91321.1	0.0	1	582	1	582
QIX67104.1	0.0	1	582	1	582
QUR50485.1	0.0	1	582	1	582
QKH97687.1	0.0	1	580	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.56e-45	73	558	187	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	4.17e-17	77	521	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000593	0.998593	0.000282	0.000196	0.000176	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002438_03273.