CAZyme Information: MGYG000002437_01864

Basic Information

• Species: Blautia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hominis
• CAZyme ID: MGYG000002437_01864
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898	MGYG000002437_2|CGC7	104316.93	4.972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002437	5878941	Isolate	South Korea	Asia

• Gene Location: Start: 754587; End: 757283 Strand: +

Full Sequence      

MRKELYAADLKVNGLTEPLGVSCEDTCFGWKIKGIGCGVVQRQFRIQVAADRSFCSEAMI
ADITEDSSRQYYYLQQALPEKTKFYWRLMLVLSYENCEEHNIGWSKCAVFETALENHYSW
KAKWIEADEDFYKEADMLCRKFWKQDAQHRGDDQGLRRNPYMRKLFYVEDGIDYARLYIT
ARGLYEAYLNGGKVGNYAMAPDFTAFNKELYYQTYDITQMLKYGENHLQVILGDGWFVGH
AQGIPGTNHLYGERPALLLQAEICYHDGRKQFFVSDEDFEVYSGPLLYADLFIGEYWDYQ
ETEKQFKSIVREYDKSILVPQKGEGVAEIEILPAVSSRKLREGEYIVDFGRIIAGRERII
FENEENRKIKIEYSEMLDEAKDGDLMELISGFPYHDQTNYLMTGNQSHLVFEPRFSFQGF
RYIKISGVENGIRKEQCEAVVLETKMRNTISFQCNNPLINQLMENVKRSQQGNMISIPTD
CPQRERAGFTGDAQIFSASAAWNQDVEQFYRRWLEQCRLEQLEKGQIPIVVPYTKAYSEN
EANPGWTSAGWGDAIIFAAWDIYRAYGDIHILEENYEAMERWMNYVKECAAEMMPERFYF
DYHNRCWQKYLWNAGFHWGDWKLPGYTDEEGAQFTKEITGSLFYYHEACTMEQICQELKY
HEQTKVYKDLKERIKTAFYMVYVSEDMRIVKEFQGAYVLALHFGIAEGREAEAFAARLNE
MVKQSGYHLQTGFLSTPYLLDVLCRYGWKDTAAQVFYQESSPSWIYQVKHGATTIWEDWD
GDLLLENGKTKGSSFNHYAFGCICDFVYRKIAGVSIEEAGFKRIRIAPEFLQGINMVELA
YETPYGLLQVKWNQSEKGTEVKIMVPHNTSAIIGEGKDVAVLGSGEHTLLYTPFGHAQ

Enzyme Prediction     

No EC number prediction in MGYG000002437_01864.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	339	873	1.3e-142	0.9900793650793651
CBM67	156	307	1.8e-21	0.7954545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.60e-101	447	811	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.20e-41	175	330	6	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.88e-15	338	442	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.88e-11	813	885	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA78378.1	8.99e-189	1	891	1	917
BBI36516.1	1.85e-186	4	873	13	893
QKS44705.1	5.48e-178	2	873	5	895
ABF44215.1	2.50e-171	10	873	8	884
AUS97594.1	8.49e-163	18	873	15	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.41e-106	9	869	34	892	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.16e-105	90	871	222	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	5.39e-102	91	887	82	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.07e-110	10	871	34	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	3.42e-106	14	873	43	876	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	9.37e-105	90	871	222	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	6.41e-81	12	871	37	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002437_01864.