CAZyme Information: MGYG000002437_01858

Basic Information

• Species: Blautia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hominis
• CAZyme ID: MGYG000002437_01858
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000002437_2|CGC7	82554.63	4.6409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002437	5878941	Isolate	South Korea	Asia

• Gene Location: Start: 742711; End: 744960 Strand: +

Full Sequence      

MEIKQIVKELTLEEKASLCSGSDFWHTQEIERLGIPRVMMCDGPNGLRKQEGEGDHLGIN
ESIKAVCFPTSSAIASSFNRGMARRLGEVLGEECQAENVAMLLGPGVNIKRSPLCGRNFE
YYSEDPYLSAEMASAYIKGIQSKDVGACMKHFAANNQETLRMSSDSVLDERTLHEIYLTS
FEKAVKEAKPAGVMCSYNKVNGTYLAENKELLTDILRERWGFDGLVVTDWGAVKDRVKGI
AAGLDLEMPGGPGAVNNEQKIINAVKNGKLSEEELERSVSAILELVMNYEEQRREKAVFD
PRKDYLEAVSAAEESAVLLKNEHQVLPVKKGSRVAFVGEFAERPRYQGNGSSYINSSYVS
TPLDTVRKMSEVSYAKGFQIDSEEIDGKLVSEAIEQARGADYAVVFAGLPNTYETEGKDR
THLNLPANQNYIISELCKVQANVIVVLYNGAPVVMPWIGQVSAVLEMYLAGDGVGDATIS
LLYGDVNPSGKLAETFPLQLSDNPSFLNFPGEEGVVLYNEGIYVGYRYYDKKNMEVLFPF
GHGLSYTAFEYSNLQLDKMQITDLESLRVTIDVKNTGGCAGKEVVQLYINDVESTVRRPI
RELKGFEKLFLEPGEVKTAEFILDKGAFAYYSVSLHDWYVESGNFLIEIGSSSRDIRAAE
EITVESTTKMAVKFSRESTVGQLMHHPKGQAMIARLTAKGGESNNAALGEGSEEMTKAMM
ADMPLGALVNFGAMSEEQLDGLIKMLNAE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	1e-72	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.50e-101	68	660	120	761	beta-glucosidase BglX.
COG1472	BglX	7.00e-70	23	352	48	371	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.70e-65	316	526	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.82e-65	6	624	56	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	8.79e-39	28	285	59	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF23779.1	5.04e-309	1	748	1	747
AHF25574.1	4.43e-305	1	748	1	747
AHF26358.1	1.81e-299	1	748	1	747
AFC28614.1	2.62e-289	2	747	4	755
AFH60784.1	3.72e-289	2	747	4	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.22e-286	1	747	3	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.11e-200	7	728	9	724	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.19e-139	2	665	5	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.91e-136	2	665	5	837	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	2.68e-130	2	657	3	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.22e-285	1	747	3	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	7.01e-193	7	728	9	733	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.80e-192	7	728	9	733	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A1CA51	2.52e-144	2	662	5	829	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
Q2U8Y5	1.10e-142	1	656	4	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999813	0.000238	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002437_01858.