CAZyme Information: MGYG000002437_01227

Basic Information

• Species: Blautia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hominis
• CAZyme ID: MGYG000002437_01227
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	MGYG000002437_2|CGC2	74566.8	4.8308

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002437	5878941	Isolate	South Korea	Asia

• Gene Location: Start: 38266; End: 40209 Strand: +

Full Sequence      

MLEKKVKMMPLGDVSIQDDFWKEYMELVRKHVIPYQWEALNDRIEGAEPSYCMQNFRVAA
KMEEGSFQGMVFQDSDAYKWLEAVAYSLMWHPDETLEATADQAIDIISAAQQPDGYLDTY
YILNGLEKRFTNLMDHHELYCLGHMVEGAVAYYKATGKRKFLDTAIGYVNCVYDNIGNAP
GKKPGYPGHEVAEMALAALYEVTKDPKHLELAKYFIDQRGQAPLYFAREREQNKNDFFWK
DSYFQDQYYQAGKPVRLQDRAEGHAVRAVYLYTGMAEVASASEDMELFEACQRIWNNIVE
KQMYVTGAIGSSQYGEAFTFDYDLPNDTVYAETCAAIGLIFFARRMFEITRDSRYADVME
RCLYNGVISGMSLDGKKFFYVNPLEAVPEASEKDFYKKHVKVERQKWFGCACCPPNVARL
LSSIGGYAYEYNEKEFFMNLFIGGSMHAVLDGKENQFRVETEYPWNGHVKIQVENEADTA
FTYAVRVPGWCRGYSLKLNGEAVKCPVENGYLLMERCWKNGDEIVFSMEMPVELVAANPR
VREDIGKVAVMRGPVVYCLEEADNQDQLQELYLSENPEFAVKYEKDLLKGVVTLTTEGKR
LSEEAWDEKTLYKPYTGRKFVPQTLKFIPYYAWTNRTVGEMLVWVRI

Enzyme Prediction     

No EC number prediction in MGYG000002437_01227.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	14	558	8.2e-227	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	14	646	12	586	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	5.47e-175	13	558	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG4403	LcnDR2	0.002	150	239	752	836	Lantibiotic modifying enzyme [Defense mechanisms].
pfam07470	Glyco_hydro_88	0.002	134	213	23	98	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	0.004	134	218	30	110	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU14959.1	0.0	1	647	1	647
ANU74938.1	0.0	1	647	1	647
ASU27747.1	0.0	1	647	1	647
QQQ92494.1	0.0	1	647	1	647
QBE99150.1	0.0	1	647	1	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.18e-245	13	646	15	646	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.70e-237	13	646	15	646	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	2.11e-172	13	646	2	657	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	3.00e-172	13	646	2	657	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	8.47e-172	13	646	2	657	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.16e-171	13	646	2	657	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002437_01227.