CAZyme Information: MGYG000002437_00966

Basic Information

• Species: Blautia hominis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia hominis
• CAZyme ID: MGYG000002437_00966
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810	MGYG000002437_1|CGC21	94067.15	4.8981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002437	5878941	Isolate	South Korea	Asia

• Gene Location: Start: 1083348; End: 1085780 Strand: -

Full Sequence      

MYIQKLNSNWYFYEAGGEEKRKAAVPGSVYEDLLRLGEMEDPYYRANETKAFDLMRKDYI
YEGTFIPDAGLLGSKKIMLMFHGLDTIADVYLNGKILGKTENMHRCYEFPVKELLKEEVN
HLKIHFHSPIQAAEEAFATCTTLGSSHALDGFPQIRKAHCMYGWDWGPRLPDAGIWKDVE
LIGVEEGRLCSVYVRQNHAQEGVYLSLFPETEVSTEPESVSYRVAVTSPDGETLTVTEKT
EGILIEQPKLWWPNGYGKQNLYTVRVEMLVKGIAADTWERRIGLRTMTISREKDAYGESF
AHEINGVKIFAMGADYIPEDNILGNITEERTRRLLTDCRDANFNCIRVWGGGFYPHDYFF
DICDELGLVVWQDLMFACAVYDLSEKFEENITHEIEENVRRIRHHASLGLWCGNNEMEMF
VDQGQWVSSLAQKADYIKMYEYVIPKILKRTDPETFYWPASPSSGGSFDNPNDPDRGDVH
YWEVWHSDKPFTEFRNYYFRYVSEFGFQSFPCLKTIESFTEPKDRNIFSYVMEKHQRNGT
ANGKIMNYISQNYLYPTDFSTLLYTSQLLQADAIKYGVEHFRRNRGRCMGAVYWQLNDCW
PVASWSSIDYFGRWKALHYYAKRFFAPLLLSCQEEGQMTQQDNVNPQPFELQKSIHLNVA
NETMEEQRAEVRWALRNRDGSMIQQESVCVTVPPLSSKWLEKTELEDMDIYHEYISYELY
QDGMKISDSSLVLCFPKHFEYQDPGLEVYAENGEIVVSAKAYAKNVEVQNENEDLVLSDN
YFDLHADCRRLKVIRGSVDGLKVRSVFDIK

Enzyme Prediction     

No EC number prediction in MGYG000002437_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	722	4.6e-106	0.723404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.72e-104	3	631	12	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	8.15e-10	655	738	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	8.20e-10	214	285	30	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.46e-09	60	416	112	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	1.13e-07	743	808	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	810	1	816
QBE97789.1	0.0	1	810	15	837
QIB54534.1	0.0	1	810	1	823
QMW79049.1	0.0	1	810	1	823
QQQ93614.1	0.0	1	810	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.15e-153	3	794	8	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.33e-153	3	794	10	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.42e-153	3	794	10	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	9.02e-153	3	794	8	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	3.75e-151	3	794	8	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.12e-113	6	635	9	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	3.07e-113	4	784	7	816	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A2QYN2	2.55e-110	6	635	9	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	1.39e-109	25	784	32	818	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B8NW36	1.89e-109	6	635	9	663	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002437_00966.