CAZyme Information: MGYG000002436_04425

Basic Information

• Species: Pigmentiphaga sp002188635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pigmentiphaga; Pigmentiphaga sp002188635
• CAZyme ID: MGYG000002436_04425
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000002436_43|CGC2	33976.27	10.746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002436	5862145	Isolate	Canada	North America

• Gene Location: Start: 33471; End: 34415 Strand: +

Full Sequence      

MPPNKDSLAKVALVTSPAIGDSLLSMTVAHNLRRSGSAVTVFGPHVHALRRWFPGIDIQP
GLSPDGAGLALEAFGTVIQLHDHRPLPDFTGLHPRAMVLEDLCRMRSPKSMATRLTEFCR
NGLGLVDAEKHNGLQPPAGLAHRLHASRVVIHPAASTPDKCWLPARFIALASRLRDEGFD
PQFIVGPAERPQWEPLLRAQGLGLPDLGGLDNVAAWVFESGWFIGNDSGIGHLASNLHVP
TLSLFMRQGGARTWRPDWGPGQVLIGSAGIPTGRLKEKLWKYVLTPGRVARAFARLRGQE
TVQAAGLPGITLLR

Enzyme Prediction     

No EC number prediction in MGYG000002436_04425.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	144	262	2.7e-22	0.5111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	6.39e-14	149	267	123	242	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	5.44e-08	149	245	178	277	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.57e-07	149	268	108	230	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02201	heptsyl_trn_III	3.99e-04	149	256	184	296	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZG11801.1	3.62e-201	26	308	1	283
QDQ84558.1	1.33e-124	4	311	4	308
AUT63401.1	4.93e-123	6	297	6	296
AUT72642.1	9.92e-123	6	297	6	296
BCG01127.1	1.15e-121	6	297	6	296

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002436_04425.