CAZyme Information: MGYG000002436_01861

Basic Information

• Species: Pigmentiphaga sp002188635
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pigmentiphaga; Pigmentiphaga sp002188635
• CAZyme ID: MGYG000002436_01861
• CAZy Family: AA3
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	MGYG000002436_29|CGC1	60764.47	9.0013

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002436	5862145	Isolate	Canada	North America

• Gene Location: Start: 32863; End: 34542 Strand: -

Full Sequence      

MNHYDYIIVGAGSAGCTLAYRLGADPALKILVLEAGGPDRSPVIRIPLTWGLILKHRMYD
WGYFTEPEPGMDGRRIECARGKVLGGSTSINGMAYARGAREDYDHWARGLGLEGWSYDDV
LPYFRRSESWEEGASDLRGGDGPLTVTRLHYEDPLVDAFLRATDLAGYARNDDYNGASIE
GFGPMQATIRRGRRWSAASAYLRPAVARGNVTVWTGALTTKVLMEQGRAVGVEVLRGGRR
EQVRCEREVLLAGGVINSPQLLMLSGIGDASELGRHGIATRVDLPGVGRNLQDHVVCDVR
WRRKETGPLHRALRLDRIGFDLLRTWMFGSGLSSKVPAAAVGLVRSHSDLPLPDLQLLLA
AAPMDAGPHLGPLLKPYVDAFAIKGVFITPESRGSVSLASGDPTAPAVIRQNFLSTDYDR
RAVRQMVRIMRAIGEQPPLAPFRAEELAPGPQATSDADIDAFIRRTAITLHHPVGTCRMG
GDADPDAVLDAQMRVRGVQGLRVVDGSAMPRVVRGPTNAPIIMMAEKAADHILGRPPLAR
DRRGAPAARRWAENEPVPA

Enzyme Prediction     

No EC number prediction in MGYG000002436_01861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	533	1.1e-159	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK02106	PRK02106	0.0	1	555	3	554	choline dehydrogenase; Validated
TIGR01810	betA	1.20e-177	5	538	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
COG2303	BetA	6.61e-171	1	540	5	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
TIGR03970	Rv0697	4.18e-91	5	533	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
pfam00732	GMC_oxred_N	1.12e-57	72	296	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWP09430.1	3.27e-135	4	538	20	556
CAB3230510.1	1.92e-132	2	538	23	561
QWC20507.1	9.73e-132	2	536	4	528
ANI26486.1	1.08e-131	4	538	71	607
CAG5089487.1	9.32e-115	4	538	17	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HA6_A	1.41e-85	5	529	3	501	Crystalstructure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]
3T37_A	2.28e-85	5	529	19	517	Crystalstructure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
6YS2_AAA	1.69e-84	4	535	8	563	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.37e-84	4	535	8	563	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.37e-84	4	535	8	563	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q988C9	3.01e-201	4	532	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
Q8UH55	2.94e-145	5	540	4	533	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
C3MIE4	5.88e-145	5	552	4	545	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
A6X2G7	8.31e-145	5	540	4	533	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
A6U6Y8	1.18e-144	5	555	4	548	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) OX=366394 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002436_01861.