CAZyme Information: MGYG000002434_00727

Basic Information

• Species: Campylobacter_A concisus_G
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_G
• CAZyme ID: MGYG000002434_00727
• CAZy Family: GT66
• CAZyme Description: Undecaprenyl-diphosphooligosaccharide--protein glycotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699	MGYG000002434_91|CGC1	80046.84	8.9194

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002434	1924634	Isolate	Denmark	Europe

• Gene Location: Start: 19442; End: 21541 Strand: +

Full Sequence      

MNRNLFFKNYSLYLMIFAAVIFGMVCRLYWVFWASEYPVFFWNNELMISTNDGYAFAEGA
RDMLAGFHQENDLSYYGYPLSTLTYWIVKFLGVKLETAMIYMSVFFSSLVTVPVILIANE
YKLKFAGFIAALLAVIANSYYNRTMAGYYDTDMLIIPLSVFVVWGLIRVLEKKDAKSLII
APLSVLIYMWWYMSAFSLISILTGLFLLYTLIFDRKNSLFYLEISLLLLSISNLDLSLKF
ALVFAVYAFCLFKKEAINLKFALAALVIVFVVFAIRGGLNPIIFQLKFYVFRGTPEVGGM
SFHFFNVNQTIQESSIVDFTLFCERISANVITFLISLAGVALFCYKHRSFAVSLGMLALG
FLAFKSGLRFTIYAVPIMGLGFGYLVEFILSNLKLKGAVLNLTRAFVTVLALTPALIHIY
GYKAEPVFVHKEVEILNKLKSIAGREDYVLAWWDYGYPIRYYSDVKTLIDGGKHLGRENF
AVSFALGSDEISSANMARLDVEYTERNFKERFNGNLAQILKERNASIDQFFSDIKEANFS
LPAKTREIYYYLPDRMLSIFPTILQFSKIDLKSGKNLNNGLFIVTRAISQNENGIRLSGG
FTLSSDVTNLIYENNVLPLRYFIETDYDESGKLNVKEYKNNELSNISVIFMRDYGRFIIL
DESILKSTYIQLFVLERYDPKIFEPVILDGAAKVYRLKR

Enzyme Prediction     

EC	2.4.99.19

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	18	566	6.1e-95	0.8744588744588745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02516	STT3	9.06e-51	6	472	1	477	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
COG1287	Stt3	2.41e-36	14	477	24	528	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
pfam18527	STT3_PglB_C	7.26e-21	581	659	1	79	STT3/PglB C-terminal beta-barrel domain. Asparagine-linked glycosylation is a post-translational modification of proteins containing the conserved sequence motif Asn-X-Ser/Thr. The attachment of oligosaccharides is implicated in diverse processes such as protein folding and quality control, organism development or host-pathogen interactions. The reaction is catalysed by oligosaccharyltransferase (OST), a membrane protein complex located in the endoplasmic reticulum. The central, catalytic enzyme of OST is the STT3 subunit, which has homologues in bacteria and archaea. Structural analysis of a bacterial OST, undecaprenyl-diphosphooligosaccharide protein glycotransferase EC:2.4.99.19 (PglB) protein, revealed two domains: a transmembrane domain and a periplasmic domain. This entry represents the C-terminal periplasmic beta-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF48117.1	0.0	1	699	1	699
QPI01671.1	0.0	1	699	1	699
QPH99879.1	0.0	1	699	1	699
QPH86773.1	0.0	1	699	1	699
QPH88490.1	0.0	1	699	1	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RCE_A	3.25e-197	14	699	18	712	Bacterialoligosaccharyltransferase PglB [Campylobacter lari]
5OGL_A	1.33e-193	14	699	18	712	Structureof bacterial oligosaccharyltransferase PglB in complex with an acceptor peptide and an lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
6GXC_A	1.89e-193	14	699	18	712	Bacterialoligosaccharyltransferase PglB in complex with an inhibitory peptide and a reactive lipid-linked oligosaccharide analog [Campylobacter lari RM2100]
3AAG_A	3.12e-50	421	697	4	289	Crystalstructure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221],3AAG_B Crystal structure of C. jejuni pglb C-terminal domain [Campylobacter jejuni RM1221]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HTX9	1.87e-201	12	698	14	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=pglB PE=1 SV=1
Q0P9C8	1.06e-200	12	698	14	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglB PE=1 SV=1
B9KDD4	3.41e-196	14	699	18	712	Undecaprenyl-diphosphooligosaccharide--protein glycotransferase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) OX=306263 GN=pglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000024	0.000001	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
12	34
99	118
125	143
153	170
190	212
227	249
262	284
326	345
350	367
371	393
400	422