CAZyme Information: MGYG000002432_01995

Basic Information

• Species: Campylobacter_A concisus_F
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_F
• CAZyme ID: MGYG000002432_01995
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
166	MGYG000002432_85|CGC2	19232.5	10.4683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002432	2010217	Isolate	Denmark	Europe

• Gene Location: Start: 48195; End: 48695 Strand: +

Full Sequence      

MKFLKQFKTIKYYKKLFIIILSLSTIATNVLAIPNANESRYNKLFYKFGKEFNIPPILLW
AIAKTESNFTNNAKNINNNGSIDYGLMQINSIHETTLKAKNLSIDDLYKPETNIQMGAMI
LRNCINKHGWDYKALNCYNGKVENNPYSRKVFANLKTLKQARRVIK

Enzyme Prediction     

No EC number prediction in MGYG000002432_01995.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	160	1.2e-19	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	1.58e-34	52	156	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	4.90e-16	14	163	2	147	type III secretion system invasion protein IagB.
pfam01464	SLT	9.05e-12	45	140	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	4.32e-11	7	166	105	265	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	1.22e-10	40	140	3	104	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH97265.1	4.07e-113	1	166	1	166
QPH89379.1	2.35e-112	1	166	1	166
AIR80975.1	3.93e-88	1	166	1	165
AHE94560.1	3.93e-88	1	166	1	165
QEL45187.1	3.93e-88	1	166	1	165

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.34e-08	49	125	8	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07568	3.95e-14	47	152	23	135	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	1.53e-13	47	152	23	135	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
P43018	7.26e-12	50	160	27	144	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	1.01e-11	50	159	27	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.01e-11	50	159	27	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001413	0.997426	0.000465	0.000232	0.000220	0.000206

TMHMM  Annotations     

start	end
12	34