CAZyme Information: MGYG000002430_01828

Basic Information

• Species: Campylobacter_A concisus_L
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_A; Campylobacter_A concisus_L
• CAZyme ID: MGYG000002430_01828
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000002430_21|CGC1	22068.19	10.3179

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002430	1891545	Isolate	South Africa	Africa

• Gene Location: Start: 30310; End: 30903 Strand: +

Full Sequence      

MRFFLFFVKPVIFATIAAKIARVPRIVGMIEGLGGAFTVHKNGQTKKAKIIKTIQVLLYK
ISLLGLTQEELKPYLDSGVVIYPGFVNDIKERIVNSSIFVLPSYYREGVPRSTQEAMAIG
RAVITTNSVGCRETVEDGVNGFLVPPFDSKILAQKMIYFIQNPEMIVQMGIESRKIAEIK
FNINEKNERLAKIIIGK

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	77	167	5.2e-23	0.56875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03808	GT4_CapM-like	2.94e-50	4	190	86	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03820	GT4_AmsD-like	1.09e-22	77	184	237	343	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
pfam13692	Glyco_trans_1_4	1.10e-22	80	162	58	138	Glycosyl transferases group 1.
cd03799	GT4_AmsK-like	3.11e-21	60	190	232	350	Erwinia amylovora AmsK and similar proteins. This is a family of GT4 glycosyltransferases found specifically in certain bacteria. AmsK in Erwinia amylovora, has been reported to be involved in the biosynthesis of amylovoran, a exopolysaccharide acting as a virulence factor.
cd03801	GT4_PimA-like	8.69e-21	69	194	240	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALF46859.1	1.09e-110	4	197	88	376
QPI00496.1	1.00e-103	4	197	88	375
QPH98703.1	1.00e-103	4	197	88	375
QPI05840.1	4.18e-88	4	196	88	374
AVX43107.1	2.72e-86	4	196	88	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XSO_A	2.30e-07	84	194	271	381	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]
7EC2_A	5.05e-06	68	178	365	475	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0P9C9	4.08e-11	74	170	251	346	N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglA PE=1 SV=1
P71053	4.76e-10	77	193	253	367	Putative glycosyltransferase EpsD OS=Bacillus subtilis (strain 168) OX=224308 GN=epsD PE=2 SV=1
P71243	4.94e-10	59	194	256	403	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Escherichia coli (strain K12) OX=83333 GN=wcaL PE=3 SV=2
Q46638	3.06e-09	68	194	290	403	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2
P26388	7.59e-09	59	194	256	403	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=wcaL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.849535	0.149349	0.000437	0.000223	0.000184	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002430_01828.