CAZyme Information: MGYG000002424_00871

Basic Information

• Species: Monoglobus pectinilyticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus pectinilyticus
• CAZyme ID: MGYG000002424_00871
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	MGYG000002424_1|CGC8	34046.5	4.3437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002424	2757122	Isolate	New Zealand	Oceania

• Gene Location: Start: 971894; End: 972802 Strand: -

Full Sequence      

MNIYVRRDYKTVKSAVEAANDGDIIVIPSGIYKEKINIAKKNLTLVGDGFVTLTYDAASG
NSDENGVEYNTFTSATVTVEETAVGFKAENITFENSYNRIDSDRAVTQALAISCGADKSV
FHHCNFLGWQDTMYIHGSETRQFFYDCYIEGSVDFIFGDAAALFEECDINCVRSKSYITA
ANTSENKEAGFVFYHCYISANENCECIYLGRPWRAQDDGINSHTAFIECTYNFDCAPVGW
LPWRLEEGTEAKNTRYLEYNNTDSHGHLIDVSERADWSRQLTHDEAETLMSYVGKFAEYP
TD

Enzyme Prediction     

EC	3.1.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	7	289	1.3e-76	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.58e-59	8	287	11	287	Pectinesterase.
PLN02773	PLN02773	5.15e-56	8	292	16	293	pectinesterase
PLN02708	PLN02708	1.96e-47	8	281	252	529	Probable pectinesterase/pectinesterase inhibitor
PLN02665	PLN02665	5.10e-46	3	291	70	350	pectinesterase family protein
PLN02313	PLN02313	1.28e-43	8	277	286	549	Pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO19045.1	7.45e-231	1	302	1	302
QRV13898.1	6.64e-58	8	285	17	284
ADB63249.1	2.13e-55	8	286	100	370
ADB61916.1	8.71e-55	8	286	35	303
AWK06217.1	1.30e-54	8	299	44	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	8.98e-42	8	277	18	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.91e-32	8	298	14	299	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.20e-26	7	286	16	325	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	1.48e-25	9	274	19	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	7.60e-25	9	274	19	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.58e-42	8	286	16	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P83218	4.92e-41	8	277	18	281	Pectinesterase OS=Daucus carota OX=4039 PE=1 SV=1
Q9LXD9	9.44e-37	9	281	251	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
O49006	1.89e-36	9	277	292	554	Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana OX=3702 GN=PME3 PE=1 SV=2
O22149	2.22e-36	8	277	216	474	Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana OX=3702 GN=PME17 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002424_00871.