CAZyme Information: MGYG000002424_00167

Basic Information

• Species: Monoglobus pectinilyticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus pectinilyticus
• CAZyme ID: MGYG000002424_00167
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	MGYG000002424_1|CGC3	61759.26	5.4682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002424	2757122	Isolate	New Zealand	Oceania

• Gene Location: Start: 186470; End: 188179 Strand: +

Full Sequence      

MADIKTKDNAKGTIRTIDKAAVATQRMKQAYIATKEKAERSVNANSSSAEEYASDKLESG
IDEVFHDGAYAFDKAGRKGLETTKENIRTAKDGIQRFKQQRAEQSLRKQASQNTSSAIKT
VDKAEKTIKQSATSSGKKTIKFAGKEATKTAQKSVKTAEQTAKTAIKTSQQAAKAAQKTA
QATVKASQKAAQAAKATAKATAATIKAAAKATIAAVKAIIAAVKGLIAAIAAGGWVAVVV
IIVLCLVALIAGSVFGIFFSGEDSGTGMSMQTVVQEINQEYDDRLEQEKNSVSYDVLEMS
GSRAVWKDVLAVYSVKVNTDPDNPMEVATVDETKKQLLSDIFWEMNDISSRTETKTHTEI
EESDDGHGNIVQTETTVTETFLYITVSHKTVDEMAAMYGFNQEQKEYLAELLKDENNQLW
SQVLYGIGYSDDQIVTVALSQVGNVGGQPYWSWYGFDSRVEWCACFVSWCANECGYIDAG
IIPKYAGCVNGVQWFRDRGQWADGSYEPSPGTIIFFDWEGDGVTDHTGIVQKCENGTVYT
VEGNSGDTCRTKTYPVGSSVIYGYGIPAY

Enzyme Prediction     

No EC number prediction in MGYG000002424_00167.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05257	CHAP	3.77e-17	454	544	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
TIGR02594	TIGR02594	3.77e-04	451	564	27	127	TIGR02594 family protein. Members of this protein family known so far are restricted to the bacteria, and for the most to the proteobacteria. The function is unknown.
TIGR00984	3a0801s03tim44	0.009	84	166	14	108	mitochondrial import inner membrane, translocase subunit. The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents.These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tim proteins. [Transport and binding proteins, Amino acids, peptides and amines]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH40048.1	1.51e-112	1	569	1	567
CBL27479.1	4.23e-112	1	569	1	567
QOV19260.1	1.18e-111	1	569	1	567
QJA01756.1	6.37e-99	1	569	1	587
QBF73722.1	1.06e-96	1	569	1	587

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
213	235
239	261