CAZyme Information: MGYG000002418_00510

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_00510
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672	MGYG000002418_1|CGC10	76518.38	4.9614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 588911; End: 590929 Strand: -

Full Sequence      

MKKTLVFMSVVLSACSITDSTTVEVMDRLATTTQNEFYVSNKAPLQPQQFIKLPVGSIEP
EGWLLKQLELQKDGLNGHLGEISAWLQKGDNAWLTNGGQWGWEEVPYWLRGYSNLSYIMK
DEAMLKETKFWIEGILKSQRADGNFGPVHQNDGKQDFWPNMIVLWIVQSYYEYSGDQRII
DFMSNYCNYLLTVPDEDFLYSYWENSRGGDNLWSVVWLYNRTGDKKLLALAEKLHKNTAD
WTKSTELPNWHNVNIAQCFREPATYFLFNKDSAMLEASYNVQSLIRRAFGQVPGGMFGAD
ENARTGFFDPRQGTETCGFVEQMASDEIMLLITGDPYWAENCEDVAFNSYPASMMPDYKS
LRYITCPNHVISDSKNHHPGIDNRGPFLAMNPFSSRCCQHNHGFGWPYYTEHLVLATPDN
GIAAVLYNACRAKIKVGDGTEITLHEQTNYPFEETVRFSIETPEAVTFPLYLRIPSWCKN
ASVLVNGKPVNAGLSAGKYIRINREWNANDEVILNIPMDYSVRNWQVNKNSVSVNYGPLT
LSLKIDEDYKKLDSRATAIGDSRWQEGADAEAWPTYEIYPGSNWNYALLTNSPITLLRKD
WPEDGNPFTFDKVPMEFKAKGRLVPGWKVDEYGLCGVLPYENAKKSDTVDDITLIPMGAA
RLRITSFPTSEK

Enzyme Prediction     

No EC number prediction in MGYG000002418_00510.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	314	540	9.8e-33	0.4217557251908397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.64e-113	23	542	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.08e-25	101	579	57	558	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADJ45365.1	1.04e-173	33	671	39	663
AFO77076.1	1.04e-173	33	671	39	663
AEK42125.1	1.04e-173	33	671	39	663
AGT84204.1	1.04e-173	33	671	39	663
AWL89945.1	1.04e-172	38	670	44	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	3.41e-17	315	544	381	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	4.71e-15	104	544	78	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.02e-13	104	544	78	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	4.80e-08	305	542	327	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.28e-07	312	542	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_00510.