CAZyme Information: MGYG000002407_02524

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_02524
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1405	MGYG000002407_18|CGC11	150027.96	4.5182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 676199; End: 680416 Strand: -

Full Sequence      

MRKATKKRELTRKMLRLGLGLLLALQLLSGASGFATAAVPPLPGPGNPLLYDDFAGGGLY
KQNWTNWYNQNGGTGAFAKTTADSRSVGKFAQTPASPASWAKFQPMNETVDLTGYRYLHF
TLKNPGYPESRIKLEINDGTTNYGLTNGWTTVPEEWTELSFDLDALTPTIRKKAVKLVVW
LNQTGGQYGEMLIDGIFATTASTGTAPTLTDAGMTSNSSGVDNQNTMYFFTATYADADNE
KPFAIQTVIDDTAYDMRETDPADADYTDGKTYAFATRLAPGSHSYYFRTTDATSDEVATP
VQPGPTVVYSEHLVDVVVSQAGYSAGDFKSASVTSTTYLTDTTYRIANGGAVVDAGSMVY
EGIVWGKHVYTIDFSAVSAPGEAYAIMTNGISSYPFPIAPNVWDRYKDEMTAFYRIQRAG
VATSDAYPPGYSTAAPSAKAFHPAGHLDDAKSEDGTAHYDLTGGWYDAGDYGKYGGNQWV
GAQIALAYVRHADSPNVKFDNDGNGVPDLVDEAIFGSEYLIKFADRLGGAMYNIRNNATF
QHPHKSTDNVPNTADDRKLTDLSVGGSAKSAGTLAATARAIHAAIAQGDVDASLVAELTA
FADECEAAAEVFYEYAEANPNGPIGSYSTRGGLPNSLLLAQAELFLLTGDTAYRDAAAAT
IGGLAFEDLYATNYWDMAPISMAELYPVMDAGTQAHIHGLLKRQVDYFLSVADDTPYGVF
NQFKNFGVNEPHASYLGDLMRYYELFGDPAALRAVQKGMYWIFGANPWNISWVSGIGTDY
VDFLHTRFDEEANKAEGLGIVIPGAMVSGPNMKDTMSKTSASPWYEDRSLYRDNISQWRY
NEFSVSIQAGLLYAVMGLGATAGAGSAGGTAPEPLPILSPVIGDYVRGSVALLADRAPGV
GSVQYAPAGGGFAPMSASGAVYAAAIDESGSAPYTNKRVDVRGVDSNGNVTYSSTHYTVA
PPLPDPANPLLYDDFGGGGWWGGSAANTNWVNWYNQSGGAGTFAKVTEDGRTAGKFAQTP
TSGSSLAKFQPSHDIVDLSGYRYLNVTLKNPGYADLRTRIEVQDGSRTANLTGGWTAVPT
SWTELRFDLDALVPALNKRTVKIAVWLKQEGGAYGEMLIDEIKATNVSSGSAPTLTAGGV
SAASGPPSADFTFSVTYADADDEPPFAVEVVVDGVVRRMAPADPGDTTYADGKAYTYTTR
LPYGNHSYYFHTSDTTSNAVSTPLQSGPAVDRTLFFDDFGDGNADGWSATSGTWSVQDGA
YVGQAGSGNSYAVAGEADWTDYTLQAKVSVSNNPGGNKDAGLVFRYADENNHYVLYLKNN
DRTGRKMELVKVAGGVRTTLAYANPSVVPDTYHEYKIVAAGDSIQVYKDGVLEIGATDGT
FAGGKVGARAYANTKALFDDVIVTQ

Enzyme Prediction     

No EC number prediction in MGYG000002407_02524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	408	855	1.1e-58	0.9808612440191388
CBM66	1243	1401	7.1e-28	0.9870967741935484

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	6.75e-29	413	855	9	374	Glycosyl hydrolase family 9.
cd02850	E_set_Cellulase_N	1.31e-10	316	398	2	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam06439	DUF1080	4.07e-07	1232	1390	3	160	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.
pfam02927	CelD_N	1.21e-05	316	393	3	83	Cellulase N-terminal ig-like domain.
cd04434	LanC_like	0.002	592	758	14	186	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58828.1	0.0	8	1404	9	1407
AIQ41638.1	0.0	12	1230	12	1237
AIQ30003.1	0.0	12	1230	12	1237
QUL53295.1	0.0	43	1230	43	1237
AIQ58732.1	0.0	50	1187	1	1145

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHJ_A	0.0	318	1232	8	917	Structuraldynamics and catalytic properties of a multi-modular xanthanase, native. [Paenibacillus],6FHN_A Structural dynamics and catalytic properties of a multi-modular xanthanase (Pt derivative) [Paenibacillus sp.]
3X17_A	8.66e-23	354	853	59	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
6DHT_A	8.37e-17	351	862	33	568	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
1UT9_A	1.13e-15	315	849	6	595	ChainA, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Acetivibrio thermocellus]
1RQ5_A	3.41e-15	315	849	6	595	ChainA, Cellobiohydrolase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10476	2.78e-30	343	855	63	595	Endoglucanase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celA PE=3 SV=2
Q05156	1.15e-23	279	851	129	735	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
P14090	2.83e-22	318	895	343	936	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P0C2S1	1.29e-17	315	849	213	802	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1
A3DCH1	1.70e-17	315	849	213	802	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000377	0.998872	0.000201	0.000206	0.000168	0.000147

TMHMM  Annotations     

start	end
17	39