CAZyme Information: MGYG000002407_02243

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_02243
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		54833.09	10.0544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 356518; End: 357957 Strand: -

Full Sequence      

MRHGATAAKTRSKRKRTSVKVRRTYRGVKTKKKSLKLKFKKVRKLKLKKSYGRLRRGKRK
GSLRLAKKGKRARLAVPVHEHPPEVVEHPPHQEPEHRGEPEEPADTGAPGFYRGINLVGF
LRAELGLGESVRLAARSLEANRIPFGILDYKEVISEGMGDSTWVHKEMGGPLYKVNVFHM
NSDSLPHCHNYFGHDLWHNRFNIGVWHWELPEFPDELCEGFNYVQEIWAPTTYVQQIIAQ
KSRVPVVRIPHGIHVDFIPELNRDAFGLPHDRYLFFMMFDLQSTMARKNPQGVIDAFKMA
FDKDDPRVGLVLKVNNSSLRPEDVEQIRPLIDGHSNIFLMDRLMNRIEVNSLINSTDCYV
SLHRAEGFGLGLAEAMFLGKPVIGTNYSGNTDFMSPENSCLVDYTMVHVGDVWAGPYQAH
QIWAEPDIAQAAGYMQQLAFNPEWRTALALRGQETIRTQFSPEVAGRMMKQRLKELGWY

Enzyme Prediction     

No EC number prediction in MGYG000002407_02243.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	8.75e-20	135	476	60	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	6.09e-17	223	465	130	357	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd01635	Glycosyltransferase_GTB-type	4.79e-15	228	402	63	234	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03809	GT4_MtfB-like	4.47e-11	227	454	142	346	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03811	GT4_GT28_WabH-like	3.70e-10	240	441	157	347	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY69755.1	4.42e-156	100	476	93	468
AEI45063.1	2.71e-137	101	477	110	483
AFK65456.1	1.74e-136	101	477	103	476
AFC32792.1	1.74e-136	101	477	103	476
AFH65128.1	1.74e-136	101	477	103	476

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1ARU5	1.25e-06	288	460	244	397	Trehalose synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=treT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002407_02243.