CAZyme Information: MGYG000002406_00569

Basic Information

• Species: Corynebacterium pacaense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium pacaense
• CAZyme ID: MGYG000002406_00569
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000002406_12|CGC4	34950.66	6.7377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002406	3028764	Isolate	not provided	not provided

• Gene Location: Start: 602433; End: 603371 Strand: -

Full Sequence      

MVTMPHTSHLHPGIDVAAVIVTHNRVDLLRHSLEVVAAQTYPVSHIIVVDNGDDAAVAAL
VAEVAGERGVYRASKSNLGGAGGFAYGFLTALALGAEAVWCADDDGRPEGVEVLSTLIDA
AARHNLEEVSPVVCNASEPERLAFPLRRGLEWRRYRGELIDPDNPGDDLLPGIASLFNGA
LISAYAMERIGVPDYRLFIRGDEVEYHRRLVRSGLAFGTCLTTAYLHPDGSDEFKPILGG
RMHTQYPDNDFKRFFTYRNRGYLMSQPGMRRLLPQEYARFAWFFLVQRHDVRGFREWLHL
HRMGRQEHFGRP

Enzyme Prediction     

No EC number prediction in MGYG000002406_00569.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	5.75e-45	14	307	3	303	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	1.18e-25	18	263	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	1.70e-07	18	263	1	236	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd00761	Glyco_tranf_GTA_type	1.73e-06	18	54	1	37	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.37e-05	15	292	4	273	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALC04706.1	1.04e-196	7	312	5	310
BAV21996.1	8.50e-196	7	312	5	310
ANR61229.1	8.50e-196	7	312	5	310
ALP48962.1	8.50e-196	7	312	5	310
QWQ83158.1	8.50e-196	7	312	5	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	2.72e-128	16	311	7	302	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	2.66e-119	15	312	4	300	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	2.66e-119	15	312	4	300	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002406_00569.