CAZyme Information: MGYG000002403_05504

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_05504
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	MGYG000002403_140|CGC3	51553.71	4.6543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 126264; End: 127646 Strand: -

Full Sequence      

MYIKDNKAEDVRITYIGGGSRGWAWNLMSDLAVEDQMSGIVTLYDIDQEAAENNVLIGNA
LQEEGKSKSFKYRACNSLKESLENADFVVISILPGTFDEMESDVHFPEKYGIYQSVGDTT
GPGGIFRALRTLPMYVEIANAIKETAPDAWVINYTNPMGACVRILYEVFPEIKAFGCCHE
VFGTQELLARLAEKEFGIDKISRNEIVVNVMGLNHFTWINEAAYQGMDLLPLYEKAAETY
KDGLELDGEKNWLNSYFANANCVKFDLFRRFGVIAAAGDRHLAEFCPGWYLKNPEVVQSY
KFSLTPVSWRKENLAGLLEKSRKQAAGEEKVKINLSGEEGVRQMKAILGLDTFITNVNMP
NHGQISNIESGVVVETNAVFSCNNVKPVFAGEMDKNILELTRPHIYAQNALIDACISHSL
KPAFLAFANDALISLPIRDIETMFGEMFQNTSKYLEYYNV

Enzyme Prediction     

No EC number prediction in MGYG000002403_05504.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	191	4.8e-57	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.80e-145	11	448	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.22e-97	11	460	4	442	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.17e-64	11	448	2	420	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	5.09e-60	12	191	1	180	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	3.59e-47	11	433	1	409	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFK85236.1	3.39e-196	1	456	1	459
SNX53414.1	1.71e-193	1	460	1	463
ANX00783.1	2.34e-193	6	455	6	457
AGC67847.1	4.71e-193	6	455	6	457
ANW98258.1	4.71e-193	6	455	6	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	9.71e-149	9	449	4	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1OBB_A	2.01e-25	11	421	4	439	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
1S6Y_A	4.84e-23	5	433	2	416	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
5C3M_A	1.57e-22	79	433	75	413	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6VC6_A	4.90e-16	13	434	6	417	2.1Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_B 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_C 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_D 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	6.78e-197	1	456	1	459	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.56e-180	1	456	1	451	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	4.66e-173	1	455	1	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	8.24e-154	9	449	8	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	6.82e-52	12	458	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_05504.