CAZyme Information: MGYG000002403_05257

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_05257
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	MGYG000002403_133|CGC4	96506.76	4.9555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 213881; End: 216373 Strand: -

Full Sequence      

MIKQSLNAQWLLQKKDSAEMFPASVPTSIYTVLAENGQIPQPYWKGNEELVRDVINDDFI
YTCTFTPSKELLKEDTAILHFDGIDTLSDIYLNNVHLGQTINMHRTWEFDITSHLKKGVN
QLQVILHSPLLAAEKAFEHCPTRGTEDAWDGFSHIRKAHYMYGWDWGAHLPDAGIFRDVT
LLGITRARIDSMYISQKHENDKVTLKFSPTFLCADNLNNFCTLEELNTPDNPDFSYSVTV
IDPDGTSLVLTENPIETEIQRPKLWYPNGLGEQPLYTVTLTLTYKGNILDQWQKRIGLRT
LTMSTEADEWGNAFAHEINGIKVFAMGADYIPEEHLLGKISSEKRRQLLTDCKLANFNSI
RVWGGGYYPDDEFFDLCDELGLIVWEDFMFACSVYQLTPEFEENITQEFIDNIKRIRHHA
CLGLWCGNNEMESFVKEGEWVSKPSEVRDYLFMYERIIPQVLKQYDPNTFYWPSSPSSGG
SFDAPQDPDRGDVHFWQVWHGNKPFSEYRKYFFRYLSEFGFQAFPSVKTIQEGISDDPDD
WNIFSYVMEKHQRNNGANGKIMGYLQQTYKYPYDFSSMIYASQLLQADGIRYGVEHFRRN
RGRCMGAVYWQLNDCWPVTSWSSIDYYGRWKALHYYAKRFFAPVMISCEEQNWMTASADM
NRQHFDFEKSIRLNVTNETALQRHVTVKWALRNADASIVKEEWQEITMAPFSAYWLDKVL
LPEADVFNQYISYEAVENNEILSQGTVIFSYPKYFNYQNPNLQAAVNGNEIIVKADAYAK
SVEILNKNEDLVLEDNYFDMNSGIRRVKILRGKPEELRIRSVYDIGRSCR

Enzyme Prediction     

No EC number prediction in MGYG000002403_05257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	710	4.4e-102	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.25e-87	3	659	12	642	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.67e-17	60	430	112	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.03e-09	187	299	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	5.81e-09	759	824	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	1.99e-05	7	434	31	421	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ91743.1	0.0	1	829	1	829
ASU31201.1	0.0	1	829	1	829
ANU78391.1	0.0	1	829	1	829
QJU15800.1	0.0	1	829	1	829
AWY99193.1	0.0	1	827	1	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	6.54e-143	6	652	11	662	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.90e-143	6	652	13	664	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	7.08e-143	6	652	13	664	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.86e-142	6	652	11	662	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	7.63e-141	6	652	11	662	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	4.76e-105	3	679	6	690	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q95327	5.55e-103	5	645	24	692	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
A2QYN2	3.81e-101	5	692	8	699	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q29444	1.54e-100	5	682	24	729	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
A1CGA8	2.84e-100	14	658	21	672	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_05257.