CAZyme Information: MGYG000002394_02241

Basic Information

• Species: Prevotella rara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella rara
• CAZyme ID: MGYG000002394_02241
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
987		106477.35	4.5663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002394	3788330	Isolate	Russia	Europe

• Gene Location: Start: 58866; End: 61829 Strand: +

Full Sequence      

MRKLFFSCLMLAASLCPSVAQQAETLGRGLVAVKTKAGVYLSWRCLTSDKSSLGYDVYRD
GVKVNAEPITGSTNYVDASGTADAKYVVKAVDGGQVVEATPEAAVWPEVYKKVHLDRPAG
GTTPDGVAYTYSPNDCSVGDVDGDGEYEIIVKWDPSNSKDNSEKGAYTGNVYIDGYKIDG
TKLWRIDLGRNIRAGAHYTQFMVYDLDGDGKAEVACKTAPGTIDGQGKAVLMGDDKVTDD
YRVSSGSNKGIIVSGPEYLTVFNGQTGAEITTVSYVPLRSVRSNSQWGDSYGNRSERYLA
CVAYLDGQKPSLVMCRGYYTASYLCAWDFDGKNLTQRWLHKSETAGEGIYGEGAHALTVG
DVDGDGCDEIVYGAACVDHDGSVLYRTGAGHGDALHLGDFDPDHDGLEIWMVHEEKSAAF
PWDAEFRDAKTGDILWGQKQSGNDIGRGVVADVSEKWRGCEAWAIADYTSGSKATATYDC
KGNKVADKRPSCNFRIYWDGDLYEELLDGTDIVKRNATLTSDAAKWSLGQYSNAQSCNTS
KKTPCLSADILGDWREEVILWDGSTSSDLLIFTTTEETKYKVPCLMQDHIYRMAIAWQNV
AYNQPPHLGYYLPDRFSTDASLRAVSGQLNQTVEQGEAIEAIVYEWKNATGVAAEGLPDG
VTMSVDNSSRQFTISGTPSATGTYKYKVSTTGGETTATIEGTITVRDKIVLTPLAYYPFD
EISAGSTPNTVEGMAEAVGAPASVQGIKGNAAQLDGASYFTQMAYSQIQLGTEDFTVEFW
MKSADDAAYIFHKGSITANAAAGATGKWVGLEYKNGLLKFAVDDNVTKSEASAAGTAYFN
GEWTHTVCVRDSYTKTLKLYANGVLIAEAADATGDISDNDEPLTVGNVNVSLNNFLEGTI
DEFTIYKGAMSSNKVKERYNEYISSGIETVPSVHPADKLTLVSATSGMVVARGVGAPENI
TSGVAPGYYILIIDHGTSSEVRKFVKK

Enzyme Prediction     

EC	4.2.2.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	22	618	3.4e-250	0.9828473413379074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	24	610	2	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	1.10e-36	22	106	2	86	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
pfam13385	Laminin_G_3	7.09e-16	770	912	14	147	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
smart00560	LamGL	1.00e-05	774	911	2	131	LamG-like jellyroll fold domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73808.1	0.0	9	986	11	1026
QCP71313.1	0.0	1	956	1	998
QCD43243.1	0.0	22	921	18	915
QUT74217.1	6.27e-254	24	614	500	1089
ADL25062.1	5.34e-223	20	707	21	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	2.36e-215	20	618	8	581	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	2.59e-207	20	614	2	570	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	8.89e-202	21	612	6	589	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	2.42e-207	9	614	24	607	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	3.71e-201	21	612	6	589	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000390	0.996973	0.002005	0.000229	0.000192	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002394_02241.