CAZyme Information: MGYG000002394_00780

Basic Information

• Species: Prevotella rara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella rara
• CAZyme ID: MGYG000002394_00780
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000002394_4|CGC2	65685.89	6.2025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002394	3788330	Isolate	Russia	Europe

• Gene Location: Start: 77330; End: 79120 Strand: +

Full Sequence      

MKKLFFTVIAALCCHLTAPAGDIFVSSTAGNDKAAGTREAPLKTLEQALKQAREWRRLGS
RNAEGGINIIMGGGVYRLYKPLFIRPEDSGTADSPTIIRSADGERAVISGGTEVKGWRKG
CDDERLPAGVRGKVWVADAPMTGNRIVETRQLWAGGRKAVRASQFAYGVMERMKAFNTTD
ESITIPTPKIDLSHARQLEMTVHQRWAIAILRVREMKDMGNGLTKVWFHQPESQIEFAHP
WPQPVIDGERGSSSFFLTNALELLDEPGEWYQDYPSGRIYYYPEDGKDPNTMDITVPVLE
TLLTIGGTRERHVSNIRFENIAFEHSAWRRPLYEGHVTLQGGFRFIDGYKLAEPGLFHKA
ELENQAWIARPEAAVTAQFADSIGFSSCTFSHTGATAVDLAYAVSSSDITGCTFTDIGGT
AIMAGWFGEQGFETHIPYTPAIGSDMCNRLTIERNKITDAANEDWGCGAVSAGYVRDTEI
SGNEVSHVNYSGICVGWGWTPLESGMRNNRITGNTVTDYARQLYDAGGIYTLSNQPGSVI
SGNTISMPHPAPYATNSRAFCIYFDEATDGYTVSDNKMPQESFGYNRPGKNLKIIK

Enzyme Prediction     

No EC number prediction in MGYG000002394_00780.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	581	2.9e-189	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.78e-09	385	577	13	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.29e-08	400	577	4	133	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	8.58e-08	441	576	2	108	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	1.46e-05	409	576	5	147	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	4.61e-05	393	544	55	171	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	1.32e-274	1	594	1	595
QJR76527.1	1.33e-253	1	589	1	588
AII69040.1	7.10e-253	15	589	17	588
QUT84057.1	7.10e-253	15	589	17	588
ALA74807.1	2.12e-252	15	589	48	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	1.83e-156	15	589	20	593	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000492	0.998540	0.000424	0.000172	0.000163	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002394_00780.