CAZyme Information: MGYG000002392_01906

Basic Information

• Species: Listeria monocytogenes
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes
• CAZyme ID: MGYG000002392_01906
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000002392_4|CGC1	64083.72	5.3434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002392	2941624	Isolate	not provided	not provided

• Gene Location: Start: 13993; End: 15651 Strand: -

Full Sequence      

MPWRGILDELENKIIDQLTEAEEHATYNGKWHGFLTIGYKNKRATVINFSYLCLANLINE
MKKSAIKNQTEEAISFKIDVAVDYQLENLGEWNKKALKTKKNYYRRGIALNENFKIALME
QEINANAILLPGDEGLAINVENMNRYLIQTNKNQAQLNLTVDSTIVTFNTVGWFFDGKKI
YDLETSELEHGRRNTKQVTPDAVFELVGNAGNYLASQVNQTGEFNYGWFACFDKKIKHYN
SLRHASTTYSMLEAYELTGDKTILEAATSALTYLEQNFIYEKDDLAFLIEPELREVKLGG
SAATLLALTKYMKITGTKTYLPLSRKIANTILSLQEEDGKFTHVLEYPSLEVKDIFRIIY
YDGEAVFGLLRLYEIDRDSKWLEAAAKSFDHFIRDDYWQNNDHWLSYCANEITKYIPDEA
YYEFGLKNAFDNLLFIYERETTFPTFLELTVATKEMSLRMKAEGLEGLLRDYPLDELEKT
ITKRALYQLNGYFYPELAIYYKNPARIDGSFFIRHQSFRVRIDDVEHNISGYVRYYHLLK
QGKLSNEAETVK

Enzyme Prediction     

No EC number prediction in MGYG000002392_01906.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04434	LanC_like	5.78e-06	205	339	123	259	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04792	LanM-like	1.68e-05	245	404	549	694	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04434	LanC_like	7.30e-05	249	451	9	184	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04434	LanC_like	4.46e-04	249	408	59	217	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
COG1331	YyaL	0.001	249	392	418	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGX91315.1	2.70e-121	94	541	95	548
ASG64311.1	3.26e-120	63	535	402	884
QLF93148.1	4.84e-116	85	541	76	544
AGB80024.1	4.22e-115	67	543	68	551
QLO25841.1	9.49e-115	43	538	48	549

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002392_01906.